ELF4[ 4 (444444  pp^TJ TTHHH Ptd| |h|h,,Qtd/lib/ld-linux.so.2GNUf{\6GT*gzmlgv\ zr)ZINw_6p1elsMuo&.+q(;#=kIraNRm](cyzsk9*_E]<5?aA`X c?U5?Y]N?g p0l [g~fQY21(NH!DUGKY$>~P %4LBj|s01w`E9+ddY$wDcG~0S7nf v!o" sR8~VOGp'A;[tKFn#ps8/B`A}aT_-^+%Z\'Ke(4AB VOSVFH[XV~YRonUP^ri @=V> Oj+k#L.ufE8{8FxAO x3,Q4U4f`yI97_ba]&v,4.;JwiC/YVb,}cRE{yW:R<iy}8iZ"M/!SOb8Lx.lq.2.J&M-1>&=42h3x99>   u%7Ed UztcY)\wb^tWce;6< M3Q2CB."|"xOl b$yC1Xk 6W&  ,J XP/irO+'A_5uNTc@C7;B  H1W}\G"CWa2 'L~kH>c"qJeDrk9!fQS`Ine6(u/ZL#y$T7FtH}MNzl54p/M331js;)vFQCBzM\(0[" ;SE*zd Xj-<0vIg)?{b7 Pg^ [&N0uytb)A! iK]**@:m|m:fp5%!I->$C2:Y\</r@+?:bBGL{el?oS Ov7<9Vj^%o0u-,,i #S% #Q[qkf2o6v3KUu6Hl`vihq<xxo9V|_dpg|2 -Gn%ZN U\p7^#F]j~LQJkD8}F{tZ{')= QUjK5:|:$X/ AhDmT+)| w(r@!3  mEPw~&[q$qJDh]@`Ch'} &)RtLKPKn=j ]4,Dr!IW*X>ed n(Zd tJF< `%JWn'H1B, ?Gye-'=hwX8Z_6sT{x=h[o*dW5#_mq^*PSg|$ zP+:aTaa MI5@=T.D"}Rs0h;H@3m-E> R^`   :-Xu  *Y >XTd C t@q 6 0 < K%@O   o 5\pO y PE H 8vpR# 0 p  % =  L^j si \  P ht `  @v $`40  <a M`  Z  z`_ E e  rP? Pj " (j.qm/mP  I & `l@- I S0 \ ( =  t m 0 > 0c  H P  U i  f Y  -q v `  a d d  P! + @  R s E j c    K  @ - @I  = $ I  ( [ ` # j  q  e F    tm P 4 d 3  { m   _  d # _ # 0 K`_@vH uT S ly F     6 + B 3 h  .|  ;XvRer  GZ (xn 0 Ge   6 x )  M 8 @h S *  d <8 F  [ vmW F   п    1 dq = 2@c  $ U !f  / G BFN ZDi`  2   `O  7 /" K a T  04  D@n  "n  /  ?4 R! ; g@N  wh  =     AOhn`x tXy T f`%  г U $ 3pl  BDvIM. \1  z\ m a Q  - 0  h  q> P\ 3     0 x .] 8 _ ?@I Z O Y8hL X z@n `P~  \ #  nwl?   E ; `   Ft@~   \ (! o 9O  gHP j ` ? l  @5 0 @r   ' t +|p 3 'j 9 +  dxPc% 0 3 = t %GZ ) cI P  `   LyM ` ` % w6D  pz(0 6 J f \ dhqLq\0 N 0]  <`<  6 N T v& 2   :E!q W`I uP  h  ,P DO / Z 27 c  D Ж h =k)  pz , x+n 5 c Hdb c O P m*5 @" 9 A  7 HuN E s k .@ ^ Ll. \yлh @   $ `p  *  7p, K $d1V  nc  xpl     ]  (  d ( ` H Q   -  &9 7@  B  RLZP1' nІC y: t `DP P i 46@  0  h    A % c 5а< CpT0 M n01]  , 4 ";:y XK p R @- Z      '4 y 4 <P GP `P . o ` * }  (`n 0 @  z^T @~ ` . j R 0e   p   )( - p ; > w pfS <\ Pu  r S D  Y l PMf s  Po  t t v! !8(!l m C!Q!D_!a F e!{!p  ! .! !hq!  ! !x!p  !` " # "p  3"  J" X"P n"$w"2  "p " 3 "T3, "   "@ d Fn"q  " "  #  @G # I 5#0  M# w `#  q# B #`S v # - #' #d#~# $p > $p   ,$+  >$0  M$_ b$j$<v$% N $ b 4V$6 `"$ % $0 $ $ $%0 A %t %`  7S,%8% x H%P - \%`l l%E %`z Z %P  %@ E %= %0n  %' c %  %&pU] &0c   :&,W&  e&J Rz{&P0  &` Hl&  &} &y&@ g &0 & &b ' 'Ѐ +'H'@J  5U'`'Y w'P0 'p;  !''@sK S 1' D ' G F:'k W '  '` G P^  (|(@"(0 2( 2 A(J(`IS(0 g(  }(H((( ( E (pf ({  )  )$)`( E/)0  =)P*  Q)  ]) I n)@ob |) N 8 )< )0y) + )n  )?h)X) C )x*l  Q2 * | !*P7Z5*k N*f*~s*!**`  *|  * ?:*  * *o @ *+p  ]+-+}y >>+( ? X+( x m+] r +P r + +,+ +  Pu +@V O +0': +  p   +@] ,P  ,  *, T 7,`vD, G mo], f,@m  s,d , t ,`  ,`  l, | 4 ,P, m ,Ps ;--| 1- % Q-   e-{ }- , -3N -gw -`h  -H-H.D.e  #.  ..   @. a.` hj.@ ~ s.~ .d.7  .ЌT .  . .0  .`  .0 < . /H/`} / , 7/ f L/@1 p _/m/yC x/ps _ / x  /\//X  /m  /  / 5 / K @NИ; /0U P 0w "0  ;0Y0 > o00C 0Pd p 00x0h  0M & 0< F 0 a1p   &1  >1 O1i10 t u1pm  1Pr# 1؇a6t9 10 6 1` $ 17 1P M 1P  kP6 10  2V )2! ; _  :23 F24i2/  |2U S2t2 # 2a 2 2 f 2,20, 3W )3$ B3`  M3p' d3f }3l  33 3  3 G 3H3 B 34!4@X  !4w +4`<4  I4M` b4 {4DEY  4P 4h44x4  4- 4  44z4zy 5@5@  15@{  @5/  Z50o  g5p5 5`R b 50  5@\ g 5 55H6  6  +6066p  F6& ]6@w p6  ~6J 66 6 I l.  6  6 L 6W i 6 67$7X *7t 47  J7d\7u7К $71 [ 7 777 7 _ 7* C 8L$ (84v58  v(E8P%   X8`  d8 8p  88% . 8  8D8PM $ 8M w 8 9 A 9H 9` *9  <9Pc = kjC9d*pp  i^  T9P V` : c9pB x99 9o 9 !9$ | 9P ) 9mW 9 M 94:h  :Q W : 6 .:j H :: f K:xR ]:p  s:GN :$v:   : : $ : O U1:q:` :;@ S ;Pp / (;H  R$A;XY;0 g f;Ѝ O n;  };U  ;pT UlQ  ;@  ;\sj9;  :`u;  ;P A ;.  <<  >?<p [ N<a<]  |<d  <<`<{ <  < y 5 <0 _ <` + <(=p#='  8=A=" G |P=  _=h  m=Ļ=@x=X =0*  1P` $ =` ==za =a  =P4 >`I k >p < *>P 6>pj ;P> u c>   r> > T > ( > 5 >  >0>0  > p >l ?@Q  ?0  G   n DY  .? P 6?@  E?$O?  _?'( m?0  t? 4 ?p ?.  ?p ?  ?d ? 3 ?wd ?y  ?p t dG @I  @ F FR  .@G  <@a O@}  ]@4 r@@  @@ @ ~ @@X@b" @  @0 X A< A  A`  1A V CA@  UA  cAvAqA $ A! A@AA[  A1 6A'  B<  B6  )B0 E 5B u BBHKBm  l#WB3 / iB& vB W B  B$ B 6 pXb B{ , B0  BH 1 BlC  Ca )C  @C0UCy  |^ z rOhC\  C  CC0  C$CC[  C B C  D R D   0D _ @D0m TD = `D  hD W {D@f s D4  DLDp E3 D C D@ ' ~DD: D L Ec  E  .E  8ET FE [E9 9qE0 + 98  ~E\EP|  ^q%E $ Eri E  Ep ; EE E} Fb e F0  "F  ,FL7F  MF gF  {FFFFF . FLFFQ  F8F F N G  G  *GW =G T YGTcG1 nG@8 }Gv G G,nO  G_ \G q G@. t ];p  G @ G GGpoHm  H@p &H  9H@"  OHYHdfHpt & wHTH  H u H( H ; H5 R H  H`J  I   I  Ip  4I, !  EI`  ;NI@ ' _IM & oI|yI Q I`yO I _ n IP d IP  I  I  ;II  J  Pr JP+JN =J1  LJ # eJ  vJ@r  J`Q  Jk ( JГ  JpJ0M  *2J<JP  JyKK|K )K; 6K P FK 5 WKp  jK%  MKP  KXKP  KPN KK_ KB  L@ C LK( L  2L  JL`l [ [L  qL  LL4LLh0Wp2l L0 A LLsMr M@ I .MIMiM@  W xMg Mu  MTM  M \ M@!s MP V M|M pM< N0  N$NPa 9 *N q  2:9NF PNX\NoN. c N\N@  NT NP M N0E  N  N1 N`^   O 7 Oq (O G W :OhMO$ZO@b jO ( OР  OxO& Of 7 JO\O  OLO  OOP C P0^  P`PH7P  HP _  PPpaPymP5  xP   P} ' PJ|P c  PM : Pph P H P(PP  P  QM Q  +Q   ;Q\Qp H lQDyxQ`) Q,Q  Q  Q) QQ0 F Q  QXR  R@U  &R u :6R0~  ;R0  RRk Q aRPX kR@{ rR̻/RH _ a R M R  "AR R`  R0  RPS R r S  Sc % S>Su  RS + np fS e zS S@  Sp  XS`&((vSPS@  SyS`P  S / +LI T T.  Tj  -TBT0xPTD[T@ eT@    To o T $ T  $  <T  {lTp TX T 7 UG ! U" B 9U }7IUdYU@z  iUm  uU   U8D)U y? U $QH U=  UE U  ^R U0/ W UL !U@q  B   V} V  Y^)Vm \ 3V\  BV`h  RVaVM `vV V5 , fV c% VP V@ X VP  V l } V" Wj  W- / .W@} >WR  KW N `Wpd < rW  aAW0vW  WP   W C Wx W E W5 W e  W0  X" %X@  4X@ * @X  ^Xh nX~N wX( X0 [ XЃ " X? F X]  X$Xr  Y  Y   rs.Y C/ :@Y  KY 5 WY  hY  tY@`!` F YXs Y` T Y & Yd  Y) C Y0 w Y(Y  ZkZ Z0& b (Z 2 BZ,v XZ *rZ@O`b ZI   Z\zZ0M  Z] ^ P # EZ,  |@ T Zp Z  Z Zp'  [x[ )[Y  5[d F >[U[l  c[`e  {[Є  [L c"\[ H }MR`N [ ` [4[`[  [q C [ ; [  \p  \0 2\P  A=\  H\C W\P i j\ B \$ ( \LE\  \ + \l\L  3\ .  +]H']P  ] 4 (]0 w :]P   G]  X]tE r]p6% ] 1  ]pj ]  ]c A ]8]]0T D ^$^0/ 3^ YA^<M^P]3 <c^)  w^@ ^|,^0  ^PZ ^^Hz^ ! ^_ & ^0 ^в  _p  _`  *_p2 7_   F_7 T_V k_ _@  _/ \ 1 _ F _  _  __ l _ 0_ V `  $`Hv.`W G`t? Q` [`y {` # ``  `  `"  ``0aP N a`N  af l )a9a  Ia" 9 _a\za  aa  a@'a& | a  a9 a9@a@o b $b8:b`GU AMb ]b`| ? lbY M <wbP  bb  bHxb bd bP, bb` i cc` # )c   :c@uCc @ RcM / ]cTjc cPscc  +c c c@ c`  cE  cd W d J d ! . ,dЪ B V0Bd t IdVd1bd$uydx~d sG r _Fdhd dyd d Y d0^ d P &e   bOx^,e v  e-eP  @e  Xe ! El@ 8 `eue`  e e I et t e  eX e@z e b e@* f] (fZo $fp0fy;f0 2 Of0  gf yfP}  fx f 1 f.  f?  fZ g0h g(g   7g   Og<\g & eg@ a ,ugPg` ^ g`m  g% j ggHg d g0h H gh  h  -h7h  Ph}9 \h  jh - hdh?  hp}( h0O < h0hf6h`>   hxhs ii0iP P;iPi(  fi0m xiz q idipi} i } ii ) i , j  .jp B Ij`8Tj'  hj W qj  ,jj,  N jm  N4X j@e j8xj  j0 s k t@r  t`/ Mt / EDgu p libdl.so.2dlerrordlclosedlsym_Jv_RegisterClasses__gmon_start__dlopenlibc.so.6putcharsetgrentstrcpysetrlimit64unsetenvwaitpidioctlgetserventgetgidsysconfstdoutgetdtablesizecfgetospeedsetserventreaddir64__strtoull_internalsigemptysetfdopengeteuid__mbrlenmemmovepathconfwcslengetegid__strtol_internalgetpidgetpagesizeqsortfgets__strtoll_internalmemcpysetvbufreadlinkdup2mbrtowcgetuidiswlowerisattyconfstrendpwentsiglongjmpvsnprintfwcsncmpsocketselect__strtoul_internalfflushputenvlseeksigaddsetstrncasecmpsetpgidfreeaddrinfowcscollalarm__sigsetjmppipestrrchr__ctype_tolower_locnanosleep__strtold_internalgai_strerrorgetrlimit64__ctype_get_mb_cur_maxsetpwentstrcatchdirendgrentumaskferrorstrstrsetgidiswctypestrcollstrncmpwcsrtombsstrncpyunlinkgetrusagestrcasecmpwcwidthtowupper__strdupsigfillsetforkgetgrentstrncatsigactionwcschrkillpggroup_membersbrk__xstat64regcompgettimeofdaylocaltimememsetclearerrgetppidtcgetattrregexecopendirgetgroupsttynamegetpwuidgetcwdstrsignalgetpwnamgethostnamesprintffclosesetlocalegetpeernamestderr__lxstat64fputc__ctype_b_lociswuppergetaddrinfostrftimefwritetcgetpgrp__errno_locationwcsduptowlowersigdelsetwcscmp_IO_putcfileno__ctype_toupper_locendservent_IO_stdin_usedgetpwentwctob__libc_start_mainlseek64regfreefputsclosedirfcntltzsetsetuidtcsetattrwcrtomb__fxstat64vfprintfstrpbrktcsetpgrptcflowsigprocmaskmbsinitfopen64__environ_nc_tparm_errrl_kill_lineread_docarray_expand_indexall_array_variablesdebugging_login_shell_rl_enable_metarl_funmap_namesbind_array_variablejust_one_command_rl_free_history_entrymake_select_commandsh_getoptcurrent_jobSPsort_variablesmake_word_flagsrl_deprep_term_functionrl_restore_statextrace_print_assignment_nc_set_bufferrl_display_promptstream_listxpg_echoupdate_export_env_inplacerl_ignore_some_completions_functionmake_default_mailpathdstackrl_line_buffercheck_identifiershift_builtinterminal_pgrpexit_immediately_on_error_nc_tinfo_fkeysmaybe_save_shell_historylocaleexpandfg_builtindirs_builtinstrip_trailing_ifs_whitespacetparm_rl_complete_mark_symlink_dirscompspec_disposeallow_null_glob_expansionlogout_docsetup_glob_ignorerl_vi_checkshopt_builtin_rl_erase_at_end_of_lineextended_globttsetattrbrace_expand_rl_strip_promptcompgen_builtinrl_vi_yank_torl_vi_completerl_dingtt_setnoechobegin_unwind_framerl_tty_unset_default_bindings_rl_get_char_lenrl_kill_texthistory_comment_charglob_vectorget_dollar_var_valuerl_macro_dumperbuiltin_docset_bash_input_fdstrlist_appendoriginal_pgrprl_instreammake_builtin_argvrl_read_init_fileremember_mail_datesexpand_words_shellexp_rl_history_saved_pointfind_flagarray_to_word_listinitialize_shell_variablestgetnumrl_completer_quote_characterszcatfdrl_crlfsh_optargrl_directory_rewrite_hookrl_filename_completion_functionstatic_shell_builtinsfind_string_in_alistsource_doccurrent_command_subst_pidload_historysv_strict_posixcopy_function_defrl_vi_matchset_signal_ignoredpromptvars_rl_with_macro_input_rl_output_meta_charsinternal_strmatchrl_rubout_or_deletesubshell_envpshell_version_stringparser_errorlist_stringneed_here_docset_current_prompt_levelfilter_stringlistsignal_is_ignoredcopy_function_def_contentsrunning_under_emacsrl_arg_signrl_key_sequence_lengthrl_filename_quoting_functionshell_function_defsall_visible_functions_rl_dispatch_subseqhistory_max_entrieszreadcxtrace_print_cond_termrl_markhas_keytype_builtinrl_untranslate_keyseqprint_cond_commandhash_builtinexecute_prompt_commandsource_file_rl_vi_set_lastttnocanonsearch_for_commandlegal_identifierhistory_set_postt_setonecharwdcacheextract_colon_unitsh_invalidsiguser_command_matches_rl_restore_tty_signalsxdupmbstowcshistory_lines_this_sessionvi_insertion_keymapsh_unset_nodelay_mode_rl_vi_last_commandall_shell_variablesit_groupsrl_end_undo_grouprl_call_last_kbd_macrorl_vi_replacerl_set_keymap_from_edit_modebind_variable_valuede_backslash_nc_tparm_analyzedelay_outputlast_command_subst_pidvi_movement_keymapreturn_catchset_locale_varsccs_versionsh_restrictedrl_completer_word_break_characterswith_input_from_buffered_streamrl_filename_dequoting_functionansic_shouldquotearith_docarray_to_stringfind_user_commandsv_localebash_history_disablehistory_expansionarray_dispose_elementset_return_traprl_modifyingrl_discard_argumentbreakingcurrent_command_numberrl_vi_ewordrl_reverse_search_historyhistory_expansion_inhibitedbg_builtinarray_to_argvmaybe_execute_fileexpand_string_to_stringrl_dispatchingbash_directory_completion_matchessave_token_statepre_process_linewrite_historyprint_var_listset_job_control_rl_unget_char_DYNAMICrl_redisplayset_ppidno_line_editingsh_badjobrl_show_char_rl_digit_valuerl_executing_macrodiscard_unwind_frameprogcomp_insertcolon_builtincurrent_fds_to_closehistory_expandstop_making_children_rl_terminal_can_insertrl_already_promptedit_jobsnoqiflushinitialize_itemlistrl_unix_word_ruboutcommand_errstrarray_subrangeshell_pgrpnohup_all_jobsrl_bind_key_if_unbound_in_mapcurrent_prompt_stringarray_quotezreadintrrl_vi_start_insertingrl_clear_signalstgotoposix_initializerl_revert_linerl_reset_after_signalsh_backslash_quote_for_double_quoteshash_walksv_ifscompspec_createcopy_wordrl_numeric_argrl_dump_variablesrestore_parser_statehup_on_exit_nc_warningmax_input_historyrestore_pipelineprog_completeskill_current_pipeline_rl_overwrite_ruboutfull_pathnameclose_buffered_streamadd_history_timeinterrupt_immediatelybuffered_getcharbash_logoutrl_set_retained_killsset_pwderr_badarraysub_rl_make_prompt_for_searchrl_bind_key_in_mapstrvec_flushaddtimevalsave_pipelinedescribe_pidperform_hostname_completionextract_arithmetic_substread_builtinrl_deletereadline_echoing_pwcsmatchxtrace_print_select_command_headrl_insert_comment_rl_init_terminal_iothis_shell_builtinfc_docmake_absoluteexit_shellmaybe_set_sigchld_trap_rl_update_finalprog_completion_enabledhistory_reeditinghistory_set_history_staterl_vi_first_printdeclare_doclcurrentrl_line_buffer_len_rl_vis_botlinthis_command_namerl_free_undo_listrl_insert_closeget_word_from_stringrl_overwrite_modeexpanding_redir_fp_hwinteractive_commentsdefault_tty_job_signalsuse_envcontinuingget_random_numberxtrace_print_for_command_headrl_menu_completenetopenprogcomp_searchrl_display_fixedmake_subshell_commandhistory_total_bytesexit_builtinparse_and_executeabsolute_program_rl_undo_group_levelit_variablespop_scopeinternal_wstrmatchifs_varrl_directory_completion_hookdump_translatable_stringsget_variable_valuerun_unwind_protectsstring_rest_of_argsread_but_dont_executerl_vi_columnrl_executing_keymapunset_docrl_yankget_job_by_namemark_modified_varsrl_readline_statedel_curtermrl_explicit_argrl_completion_entry_functionrl_catch_signalsunclosed_pairbreak_docxtrace_print_arith_cmdtrap_list_rl_possible_meta_prefixesrl_filename_completion_desiredsubshell_environment_rl_pop_executing_macro_rl_dispatchmake_variable_valuecaller_docreadline_internal_setupttgetattrtimeval_to_secsrl_vi_delete_torl_ruboutrl_noninc_forward_search_againrl_delete_horizontal_spacerl_undo_listignore_signal_rl_adjust_pointdescribe_commandexpand_wordsreset_mail_filesrl_history_search_backwardrl_donerestart_job_controlword_splitrl_variable_bindpopd_docphash_removesubshell_levelfind_index_in_alistlist_lengthsourcelevelsh_cfreewith_input_from_streamifs_firstcrl_insert_textrl_refresh_linerl_vi_goto_markcommand_error__fini_array_endhistory_get_history_statemake_local_array_variable_rl_init_line_statetilde_expansion_preexpansion_hookit_filestype_docyyparse_nc_doallocinitialize_job_controlcontinue_builtinset_signalrl_vi_eof_maybetest_eaccesspwd_docinit_yy_ioget_current_prompt_levellogout_builtinsh_setlinebufparse_symbolic_mode_rl_convert_meta_chars_to_asciish_nojobswhere_historysh_syntaxtabassign_array_elementmake_local_variabletgetflag_rl_kill_kbd_macrofind_function_def_nc_get_tty_modeclean_simple_commandtrap_docvalid_array_reference_rl_is_mbchar_matched_nc_add_to_trydispose_redirectsunbind_function_defskipsubscriptremember_argsarray_needs_makingecho_input_at_readbrace_expansionreturn_EOF_rl_term_gotorl_on_new_line_with_promptpipeline_pgrp_nc_curr_lineuitosemacs_standard_keymapmaybe_add_historysh_freemake_function_defcurrent_user_rl_input_queuedindirection_level_stringit_shoptsrl_vi_append_modereadline_top_level_rl_savestringstrlist_from_word_listset_or_show_attributessv_histignoremaybe_make_restrictedexec_doctermination_unwind_protectpush_contexthistory_getprivileged_moderl_vi_prev_wordget_hostname_listrl_restore_promptcolon_doctimes_builtinexecutable_or_directoryrl_maybe_replace_linerl_unix_filename_rubout_nc_unicode_localereadonly_builtinstrip_trailing_rl_compare_charsrl_display_match_listwait_for_single_pidthe_printed_command_except_trapnum_shell_builtinstime_to_check_mail__libc_csu_finiset_dollar_vars_unchangedget_history_eventrl_set_signalsprint_simple_commanddot_doc_rl_term_icstdin_redirectsrl_maybe_save_linemake_arith_for_commandrl_noninc_forward_searchtilde_expansion_failure_hook_nc_rootnameglob_error_returnmailstatexit_docmaybe_append_historylist_optargsh_double_quotebash_history_reinitpop_var_contextsetup_async_signalssh_mktmpfpstrlist_sortshow_var_attributeshash_bucketrl_forced_update_displayrl_unbind_keyrl_clear_pending_input_rl_completion_case_foldunlink_fifo_listrl_forward_search_history_rl_complete_show_unmodifiedstrlist_printstring_list_dollar_atrl_bind_key_if_unboundexport_docbash_brace_completionsv_globignoreit_servicessource_builtinrl_noninc_reverse_search_againmake_pattern_listmake_bare_wordget_group_listrl_completion_suppress_quoteread_historydisown_docterminate_stopped_jobsrl_library_versioninitialize_flagsthe_current_working_directoryttytyperl_quoted_insertrl_copy_textbuiltin_usagerl_vi_domoverl_alphabeticTABSIZE_rl_term_autowrapend_job_controlrl_vi_yank_argifs_cmapnumcodeswithout_job_controlreset_signal_handlersrl_gnu_readline_prl_attempted_completion_functioncurrent_readline_promptget_job_by_piddef_shell_modemake_redirectionfind_special_builtincopy_redirectstime_docfile_error_nc_err_aborthistory_arg_extractrl_vi_bWordbash_add_historyskip_to_delimget_alias_valueBCit_runningsh_get_env_valuesh_notbuiltinrl_getc_functionrestricted_shellparse_and_execute_cleanupit_signalssh_needarg_rl_vi_done_insertingfunction_trace_modeexpand_word_leave_quotedhistory_word_delimiterssh_syntabsizshell_start_timefail_glob_expansionbash_dequote_textstrlist_copyumask_doclocaletransrl_readline_nameset_dollar_vars_changedhistory_no_expand_charsrl_tty_statusvariable_contexttilde_initializerl_unbind_function_in_maprl_unbind_key_in_maparray_create_elementrl_transpose_charsevalexphistory_lines_in_fileparse_commandgive_terminal_totilde_expand_wordvar_lookupreset_prog_modeexecuting_line_numbersh_exittrap_builtinhelp_builtinsignal_names_rl_current_display_linekill_docsh_invalididdot_found_in_searchset_default_locale_varsrl_beginning_of_historycopy_commandstrlist_disposeindirection_levelbash_re_editlegal_number_rl_complete_mark_directoriesmake_here_documentrl_username_completion_function_rl_set_insert_modepolite_directory_format_rl_vi_textmod_commandsh_set_lines_and_columnsparse_string_to_word_listdo_assignment_no_expandcheck_window_sizethe_printed_command_rl_term_clreoltt_setnocanonrl_forwardlast_history_linehistory_quotes_inhibit_expansionbind_docnocbreaksv_histsizeno_symbolic_linksbinary_testmake_group_commandrl_digit_argumentsv_tzset_shelloptsrl_backward_wordget_minus_o_optscase_doc_nc_user_definablesv_pathrltty_set_default_bindingsrl_vi_back_to_indentthrow_to_top_levelsubshell_argvit_enabledassign_array_var_from_word_listsh_mktmpnamestartup_staterl_last_funcarray_disposesh_invalidoptfc_builtinidcok_nc_set_typecdspellingbind_builtinmove_to_high_fd_rl_qsort_string_comparerl_completion_suppress_appendfd_to_buffered_streammake_cond_commandttonechartilde_additional_prefixesunbound_vars_is_errorrl_expand_promptinitialize_aliasesrl_get_keymap_by_name_rl_allow_pathname_alphabetic_charswait_builtin_rl_disable_tty_signalstest_bracket_dochostname_list_initializedrl_completearray_to_assignpop_contextsource_searches_cwd_rl_control_keypaduinttostrsv_ignoreeofidlokbash_servicename_completion_function_rl_find_completion_wordexpand_string_unsplitrun_unwind_framehash_stringrl_completion_display_matches_hookunfreeze_jobs_listall_visible_variablesglobal_commandtrap_to_sighandlermake_until_commandexpand_word_unsplitxmbsrtowcsrl_blink_matching_parenunset_sigwinch_handlershell_is_restrictedhistory_write_timestampssh_reallocfind_variable_internalmake_bare_simple_commandsh_notfoundrl_filename_quoting_desiredmake_simple_commandsignal_is_trappedrl_resize_terminaldebugging_moderl_char_searchsh_badopt_rl_last_c_posarray_flushsame_filerl_terminal_namehistory_listkill_all_local_variableshistory_delimiting_charsfg_percent_docprint_var_valuethis_shell_functionpatch_levelrl_arrow_keysdelete_all_jobs_rl_next_macro_keyit_bindingsbase_pathname_nc_suppress_warnings_nc_locale_breaks_acsstrlist_resizerl_bind_keyseq_if_unboundsh_canonpathecho_command_at_executedispose_wordalias_expand_wordrl_stop_outputbuiltin_builtin_rl_print_completions_horizontallybash_readline_initializedpipefail_optreset_shell_modeuse_extended_namesselect_docrl_undo_commandignore_tty_job_signalscommand_substitutestrvec_strcmpreport_errorbg_docinternal_warningrl_vi_overstrikerl_save_staterl_vi_set_markrl_re_read_init_filetrue_docdollar_dollar_pidrl_completion_found_quotecopy_word_listuntil_docrl_backward_kill_wordinteractive_shellcommand_execution_stringset_pipestatus_from_exitrl_macro_bindshell_execverl_filename_quote_charactersbash_input_fd_changedreset_mail_timerstrsubsetup_ignore_patternsword_list_remove_quoted_nullsprevious_jobget_array_valueset_itemlist_dirtypwd_builtin_rl_saved_line_for_historyget_numeric_argps1_promptunwind_protect_memrl_stuff_charthe_printed_command_sizeprogcomp_flushprogcomp_removeexecute_shell_functionsubstring_rl_term_ipsys_errorsignal_is_specialttsaverl_pending_inputerr_unboundvarstring_quote_removalyynerrssv_history_controlmake_for_commandreturn_docdo_redirections_rl_vi_reset_lastpush_scopedisown_builtinmalloc_trace_at_exitarray_patsubhistory_search_poslocal_builtindifftimevalrl_backward_bytecheck_binary_filestrvec_from_word_listexpand_string_unsplit_to_stringhashing_enabledarray_keysreset_shell_flagsnohup_jobfind_token_in_alistother_token_alistrl_event_hookeof_encounteredrl_copy_keymaprl_messageprogrammable_completions_rl_mark_modified_lines_rl_strindexresetty_nc_read_entry_rl_find_prev_mbcharlist_running_jobsexec_builtinprimary_prompt_rl_char_search_internalrl_yank_nth_arghistory_get_timeshopt_setoptwant_pending_commandbash_groupname_completion_function_rl_set_cursorlast_shell_builtinrl_set_paren_blink_timeoutcd_builtin_rl_isearch_terminatorsSBnew_var_contextrun_pending_trapssh_mktmpfdsync_buffered_stream_rl_to_upperrl_completion_mark_symlink_dirscurrent_host_namequote_globbing_charstest_docremove_history_nc_name_matchfalse_builtinrl_redisplay_functionbrace_arg_separatorgrouping_braces_dochistory_tokenizekill_pidrl_outstreamabsolute_pathnamearray_insertterminate_current_pipelinerl_dump_macroshistory_numberreader_loopput_command_name_into_envsh_backslash_quoterl_end_of_lineexpand_words_no_vars_rl_free_match_listfind_variable_rl_enable_meta_keyrl_universal_argument_rl_complete_show_allrl_yank_poprl_vi_putjobs_m_flaghistory_searchstrvec_to_word_listfmtumaxset_debug_trapshopt_docrl_forward_bytefind_functionspnamebashline_reinitializewait_forrl_set_keyerr_readonly_nc_accessadd_or_supercede_exported_varungetc_with_restartpop_argstputsrl_reset_line_staterl_variable_dumperrl_forward_wordassign_in_envmake_while_commandstrlist_mergestring_list_internalrl_history_search_forwardlist_rest_of_argsrl_maybe_unsave_linehistory_docextract_array_assignment_list_rl_add_macro_charrl_vi_fetch_historyeval_docrl_vi_change_charclose_buffered_fdrl_discard_keymap_rl_read_mbstringstrvec_removereturn_catch_valueeof_encountered_limit_nc_pathlastrestore_token_statecommand_string_indexrl_endbreak_builtinset_sigchld_handlerquote_string_for_globbingunary_testrl_unbind_command_in_mapansic_quotetest_builtindirs_docsh_readonlysigint_sighandlerwait_for_jobinitialize_readline_rl_get_screen_sizestream_on_stackrl_vi_change_casestrlist_flushlist_minus_o_optsread_history_range_nc_screen_chainrl_vi_append_eolmerge_temporary_envreadline_internal_charhist_last_line_addedfind_shell_builtin_rl_enable_paren_matchingstrlist_to_word_listif_docpushd_builtinprintf_docinterrupt_statearray_unshift_elementrl_vi_search_againenable_hostname_completion_nc_set_tty_mode_rl_set_mark_at_pos_nc_init_keytrydelete_all_contextsrl_vi_substsavetty_rl_abort_internalttcbreakcontinue_docglobal_error_listnamed_function_stringcheck_add_historyrl_set_marktempenv_assign_errorprint_var_functionrl_vi_searcharray_removeminus_o_option_valuexstrmatchlist_all_jobsset_pipestatus_arraygather_here_documents_rl_to_lowercdable_varsassign_array_from_stringphash_flushprint_rlimtype_rl_lowercase_p_rl_set_screen_sizejob_slotslist_optoptbash_tilde_expandzsyncfdrl_replace_linemk_msgstrshell_namestrlist_prefix_suffixrl_completion_query_items_rl_pure_alphabeticsh_optindrl_completion_typemalloc_tracehistory_subst_char_nc_ospeed_rl_term_dcmalloc_flagsunalias_builtinPCwhile_docrl_push_macro_inputrl_kill_word_rl_rubout_charfind_reserved_word_rl_free_saved_history_lineexecutingset_if_notnumber_of_argssh_validfdget_tty_state_rl_bell_preferencephash_searchintrflushget_shopt_optionsrl_completion_modegetifshistory_offsetulimit_docprint_timevalpush_dollar_varsrl_start_kbd_macroreplace_history_entrylocal_docfunction_doc_rl_clear_screenrl_erase_empty_lineexecutable_filerl_make_keymapmake_funcname_visiblehalfdelayrl_named_function_rl_overwrite_charhistory_truncate_filerun_exit_traprl_read_keyconvert_var_to_arrayrl_byte_orientedset_langrl_vi_insert_begprogcomp_createsh_opterrset_curtermfile_iswdirarray_createrun_debug_traprl_add_funmap_entryulimit_builtinrl_copy_forward_wordemacs_ctlx_keymapsuspend_continuerl_reset_terminal_rl_screenheightdispose_fd_bitmaprl_bind_keyseqrl_noninc_reverse_searchrl_yank_last_argget_working_directoryhistory_search_prefixno_argsansiexpand__fini_array_startshow_shell_versionrl_insert_moderl_vi_fWordit_setoptsreturn_catch_flaggetopts_dochash_sizemake_command__libc_csu_initfd_is_bash_inputset_minus_o_optionunquoted_glob_pattern_pis_directorywait_docstrvec_lenset_var_read_onlyrl_basic_word_break_charactersmake_arith_commandrl_invoking_keyseqs_in_mapreturn_builtindequote_stringrl_restart_outputrl_do_lowercase_version_rl_clear_to_eolrl_backward_kill_line_rl_insert_typein__bss_startrl_binding_keymapsubst_assign_varlistrl_pre_input_hookrl_vi_tilde_expandplace_keywords_in_envbash_getcwd_errstrstring_to_rlimtyperl_copy_region_to_killdisallow_filename_globbingrl_ignore_completion_duplicatesrl_upcase_wordmaybe_make_export_envget_job_spec_rl_term_upmake_word_rl_backspacestart_job_nc_keep_tic_dirnoclobberdefault_buffered_input_nc_nulls_sentrl_tab_inserttypeset_doczreadrl_save_promptxtrace_print_word_list_rl_term_crsubshell_top_levelset_signal_handlercur_termreset_shell_optionslist_stopped_jobsinitialize_trapsrl_function_dumper_rl_read_mbcharsub_append_stringarray_shift_elementrl_add_undounset_bash_inputrl_dump_functionsforced_interactivelist_opttypecommand_connectopen_buffered_streamxstrchrsh_optoptphash_creatett_setcbreak_rl_term_eimake_childgnu_error_formatdecode_signal_rl_match_hidden_filesget_locale_var_getenv_rl_term_pcno_empty_command_completionrl_backward_chartgetent__init_array_endit_disabledtest_binopset_error_trap_nc_flushstrcodesexpand_prompt_stringprogcomp_disposedo_assignment_nc_tic_dirloptend_rl_in_streamshift_docset_dirstack_elementsh_memalignrl_execute_nextdeclare_builtinrl_complete_with_tilde_expansionrl_vi_arg_digitit_keywordsmake_command_stringhash_docexpand_stringstrvec_createwait_for_background_pidshistory_lengthrl_begin_undo_group_nc_syserr_abortcurrent_builtinxbcopycomplete_builtinrl_forward_charputp_rl_vi_initialize_linetimeval_to_cpusv_optindsetifsrl_catch_sigwinchdispose_function_def_contentshas_icrl_getcread_secondary_linepush_streamredirection_expandsh_vallocrl_unix_line_discard_rl_output_some_charsttattrrl_completion_word_break_hookdisplay_signal_listrl_make_bare_keymap_nc_read_file_entrywlcachenapmsstrcreplaceno_invisible_varscheck_hashed_filenamesrl_completion_matchesit_directoriesremove_aliasbuffered_ungetcharfg_docrl_bind_keyseq_in_map_rl_move_vertwait_signal_receivedbuild_version_rl_keymapsh_mallocrl_set_keyboard_input_timeoutrl_character_len_nc_basename_rl_pushed_input_available_rl_any_typeinget_current_user_infoinitialize_bash_inputrun_return_trapsh_getopt_restore_stateclear_unwind_protect_listdispose_command_rl_term_clrpagbuiltin_addresssh_makepathrl_capitalize_wordprotected_modefile_isdirarith_for_docrl_set_keymapbind_functionrl_backwardinitialize_signalsrl_readline_versionget_exitstatstart_pipelineunset_builtinsh_erangecaller_builtincommand_builtin_rl_out_streamdelete_all_variableshistory_expansion_chartest_unopextract_process_substread_commandrl_get_termcapduplicate_buffered_streamno_optionsconnect_async_listbuiltin_errorinitialize_terminating_signalsunbind_variablealias_expandfree_buffered_streamarray_assign_listdecode_prompt_stringlast_made_pidcurs_setrl_newline_nc_update_screensizeset_tty_staterl_vi_bracktypedisable_priv_modett_seteightbitreset_terminating_signalsreset_parserrl_vi_end_wordstrvec_sort_rl_output_character_function_rl_screencharsmbstrlenhistory_search_delimiter_charsget_dirstack_from_stringsetuptermrl_list_funmap_namesarray_rshiftsuspend_docfind_or_make_array_variable_rl_clean_up_for_exitsetup_history_ignorebind_int_variable_nc_keypadrl_vi_fwordrl_end_kbd_macrostrvec_copyrl_editing_modesecondary_prompt_nc_get_localerl_copy_backward_wordarray_from_word_listrl_translate_keyseqsh_un_double_quotejobs_docfile_statuspush_var_contextrl_bind_key_rl_fix_last_undo_of_typelast_asynchronous_pidasynchronous_notification_rl_meta_flagtest_commandit_aliasesprogcomp_sizesv_histcharsrl_generic_bindreap_dead_jobs_rl_erase_entire_linechange_flagcompletions_to_stringlistit_stoppedwhich_set_flagsarray_shiftttnoecho_rl_suppress_redisplaysh_neednumargarray_keys_to_word_listecho_builtinunbind_funcrl_vi_eWord_nc_first_nameforce_append_historystdscr_rl_digit_pread_octalbash_history_enablewith_input_from_stdinrl_get_next_history_rl_doing_an_undosh_xmallocrl_vi_redomake_cond_nodeset_sigint_handlerrl_backward_char_searchunstifle_historyerror_trace_modesuspend_builtinrl_delete_or_show_completions_rl_screenwidthrl_parse_and_bindset_login_shell_nc_curr_colnotimeoutstrlist_walk_nc_home_terminfo_nc_get_typerun_trap_cleanupdispose_saved_dollar_varsstring_list_dollar_starjump_to_top_levelchar_is_quotedreadline_internal_teardownttrestoreliteral_historycurrent_command_line_count_rl_find_next_mbcharrl_special_prefixescount_all_jobsdispose_wordshist_verifyfind_tempenv_variableshell_glob_filenamereadonly_docread_from_stdinrl_downcase_wordnew_fd_bitmapemacs_meta_keymapit_arrayvarsrun_error_trapgetmaxchildmake_case_commandrl_vi_undorl_vi_bword_rl_input_availablehash_dispose_nc_set_sourceprint_commandall_exported_variablestilde_additional_suffixesrl_initializeshopt_listopteval_builtinmaybe_call_trap_handlerfmtulongexec_redirection_undo_listkill_builtincd_docarray_variable_partset_var_attributeshell_ttylocal_exported_variablespush_argstimes_docstupidly_hack_special_variablescurrent_historycurrent_readline_linerl_vi_change_torl_vi_deletegetopts_builtintrap_saved_exit_value_rl_possible_control_prefixesrl_prep_terminaladd_aliassh_regmatchdump_po_stringsexecute_commandremove_unwind_protect_rl_horizontal_scroll_modeparse_shellopts_edatatypeaheadcompgen_docrl_add_defun_nc_free_termtypextrace_print_case_command_headnoglob_dot_filenamesexecute_command_internalglobal_variables_GLOBAL_OFFSET_TABLE_remove_backslashesget_group_arraystrlist_removearray_walklet_builtinrl_completion_append_characterunalias_docremember_on_historylet_doccommand_docinitialize_job_signalswait_intr_bufrl_kill_full_lineEOF_Reachedrl_vi_next_word_rl_set_the_lineoptflagsenable_builtinfind_aliascomplete_docwith_input_from_stringextended_quoteps2_promptnorawinitialize_shell_optionsclose_fd_bitmaprl_vi_overstrike_deleterl_invoking_keyseqsrl_on_new_lineclear_hostname_listadd_unwind_protectrl_extend_line_bufferzwriterunning_trapstdin_redirthe_current_maintainerCOLSyy_input_namenewscrfalse_docit_hostnamesrl_attempted_completion_over_rl_redisplay_after_sigwinchcmd_initset_default_localerl_vi_char_searchsh_realpathtop_level_maskrl_transpose_wordsrl_get_previous_historynodelayrl_num_chars_to_readhistory_builtinlist_one_job_nc_getenv_numprint_array_assignmentrun_interrupt_trapprint_arith_commandmakunboundrl_do_undoget_string_valueall_variables_matching_prefix_rl_term_imit_exportsrl_vi_movement_moderl_cleanup_after_signalvariable_help_docarray_variable_nameget_name_for_errorsave_bash_inputrl_bind_keyseq_if_unbound_in_maprl_get_keymap_name_from_edit_modemake_word_listmake_if_commandrl_prep_term_functionrl_beg_of_linerl_possible_completionswordexp_onlyansicstrsh_single_quotepushd_docrl_set_promptsh_invalidnumclean_itemlistyylval_rl_parsing_conditionalized_outfind_path_fileisnetconnalready_making_childrenrl_insert_completionsrl_complete_internalifs_valuerestore_original_signalssv_terminalumask_builtin_rl_push_executing_macrocurscrrl_get_keymapsv_mailprogcomp_walk_rl_eof_charsubshell_argcgen_compspec_completionsit_userscleanup_the_pipelineprompt_string_pointerrl_basic_quote_charactersdelete_job_rl_page_completionsrl_function_of_keyseqsave_parser_statestrlist_createprint_shift_error__init_array_startsv_hostfilerl_kill_regionfunmap_program_specific_entry_startrl_vi_editing_moderl_tty_set_default_bindingsset_buffered_streamrl_exchange_point_and_markenable_docreset_shopt_optionsrl_abortsv_histtimefmtcurrent_readline_line_indexalias_expand_allsh_badpidfree_pushed_string_inputdist_versionget_directory_stackprint_func_listbash_badsub_errmsg_rl_term_ICdispose_used_env_varsshould_ignore_glob_matchesposixly_correctunbind_argsrl_visible_prompt_lengthexport_builtinit_functionspushed_string_listUPfatal_error_rl_replace_text_rl_last_command_was_killinitialize_shell_builtins_rl_comment_beginrl_pointsh_get_home_dirlist_reverse_nc_baudratedelete_all_aliasesassign_array_var_from_stringinternal_errorall_shell_functionscond_expand_wordconditional_dochistory_is_stifledredirection_errorpat_substprintf_builtinbind_keyseq_to_unix_commandrl_tilde_expandsh_xfreelast_command_exit_valuesv_opterr_rl_term_backspaceadjust_shell_levelcommand_word_completion_functiongetmaxgroupsrl_insertrl_promptlast_command_exit_signalrestore_default_signalmake_word_from_tokensh_xreallocposix_readline_initializeforce_fignorerl_initialize_funmapcompspec_copyhistory_inhibit_expansion_functionno_exit_on_failed_execsh_contains_shell_metasrl_deprep_terminalcurrent_command_first_line_savedset_working_directory__data_startword_token_alisthangup_all_jobsrl_inhibit_completion_rl_last_v_posit_builtinswtimeoutshow_name_attributesrl_clear_messagerl_get_keymap_namerl_vi_insertion_modedispose_function_defhash_copystop_pipelinecopy_redirectcheck_dev_tty_rl_start_using_historyzreset_nc_outchmake_new_array_variableLINES_rl_history_preserve_pointjobs_builtinarray_copy_rl_fix_pointboolcodestteightbitstrvec_resizefree_mail_filesecho_docbuiltin_address_internalrl_delete_textextract_command_substglob_ignore_caserl_free_line_statesplit_at_delimsphash_insert_rl_move_cursor_relativecheck_bash_inputdispose_exec_redirects_rl_insert_charbash_default_completionparse_and_execute_levelmail_warningsource_uses_pathcommand_oriented_historyrl_end_of_historyall_digits_rl_init_eightbitsignal_namerl_replace_from_history_rl_uppercase_prelease_statusgetopts_resetlegal_alias_nametgetstr_rl_term_DCsh_invalidoptnamerl_visible_statsdef_prog_moderl_emacs_editing_modemap_overpop_dollar_varsrl_completion_quote_characterbind_var_to_intnotify_and_cleanup_rl_enable_keypaddispose_var_context_nc_fallbackrl_startup_hookdispose_cond_nodestrvec_disposeunbind_array_elementreset_internal_getoptmalloc_registerhas_ilyycharit_commandspop_streamclear_historydont_save_function_defsquote_escapesfc_execute_fileexpand_aliasesdispose_variableshell_initializedprogramming_errorrl_char_is_quoted_ploop_levelmap_over_funcslong_args_rl_init_argumenthistory_basesh_callocsh_physpathyyerrorbash_initialize_historypopd_builtinGLIBC_2.1GLIBC_2.0GLIBC_2.3GLIBC_2.20ii uii 'uLii 1uii uii ;uii 'u I$_(j,DH L"P)T3X?\M`mdoh{l~ptx| *+-5@I]atv' :HRl} ~$(,048<@DHLP TX&\(`7dyh|lptx|$%12BMV[\ :AFW_joq x~ $(,048<@DHLPTX\` dhlp&t)x-|?_cn 46MZ^p{U9 U5<%@%Dh%Hh%Lh%Ph%Th %Xh(%\h0%`h8p%dh@`%hhHP%lhP@%phX0%th` %xhh%|hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h% h%h%h%h%h% hp%$h`%(hP%,h@%0h0%4h %8h%<h%@h%Dh%Hh%Lh%Ph%Th %Xh(%\h0%`h8p%dh@`%hhHP%lhP@%phX0%th` %xhh%|hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h% h%h%h%h%h% hp%$h`%(hP%,h@%0h0%4h %8h%<h%@h%Dh%Hh%Lh%Ph%Th %Xh(%\h0%`h8p%dh@`%hhHP%lhP@%phX0%th` %xhh%|hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp1^PTRhp h QVhwUS[k RtX[ÐU=0tvpҡpu0ÉU4tt h4=ÐD$PvS\$j!Tu!du,`tR SI͒dt؍t&{dtŋ lt`t뫍&m막'WVS\t [^_Ít& 1ۋD$,Pq8rt ؃[^_m u'WVSL$,Q0\8-Ѕu&8rt[^_Í&m u߃ h 蝊$4葊$x 腊$s y\[^_ÍvhqPX pqQhqpqlqtqÍt&'UWVSD$jht*)OjPjh| [l$t D$8uk111K FRfDžuPWVh s .Uu1҃ [^_]WWh P*"~uءtt~~8uŋ@58HtʅJz_҉_u0 Q>'jЃ [^_]à h 1҃ [^_]ú!&SD$ jhtÅt#~to_t{jSjh Pjh  D$PPPhh \$0S@$aP@PZY[ÃZY[øZY[øZY[Ít&WVSƋ|$19RRP CQn$9uƅD$PPFRWWhh N9W@$藉PvL uPPN9WPPhh FR@$UP4Y_j QX>Wb4$[^_PPjVǧ4$?4$g؃[^_Rhh Ph P\%jjt, D$t5 px% pPMT p É p~ pPT p SRRxqtXZ[à hqRÅPPPPPh/h  Qc@$PxqCt 8Ph2h j诇/bin@/sh|qPPCPPPh3h KQ@$vPUq[xq SSh QQh8h h @$/P xqh9h j  /bin@/shh:|qh jf/pQQPRRh1h SR=@$輆P t&'Sx\27 je pd贲 TPP1u \tlPP苺$Jj!Y T1u \tP#&[ËuP &[Ívt눍t&]PPh\$ SPPSPPh`h v!‰%t u)ٍQRIP(pv (S衔Y$R蔔p 'UWVS ƉՅi LLQRh VVjjh @p t$@pt&WPh V;uVjjh Vj;jh| ~1 1  tl :su1Beu1Btu1BvuPP| WPPhh T Rt@$P ~ǃ utTRRj[WÅC;-tPPj]StPSh V hh W賄u, [^_]h   Ph" Vps LPQhVU -LUhV@Vj*jhD1 [^_]ÉJ&UWVS ӉD$;T$ 4tz-€+ Шtdk-F؉L$t/C/w$QQT$ RS @-7Guщ;l$ t D$4u؃ [^_]|7G΋\$ RRPT$R5E7G7G뎋L$9}dJEЋ\$\ 7G@7G,Ft<-~%hh PPhPSt$ Vh= (1JXj QQ|$ -%Pj7GPP|$ -ÁSj`ك 볍UWVS,EU M$j h_触Xu"{9hqtExq |q q q|qxqhqpqlq5lq1ɣtq95hq  hR 4 @QQjhyt. =$ EEu,x||5 plu=LL8-X \sb Xsk dqjThl`dhXR\`qc ÚX QV{_Xj|h S֧L8- L:sL:s L}5LLRRVPPhh S@$z}PY Ltt -uxu Ln  jc$ E 9; *9-!Džx-r @pDž1@@@ptd@p8QuPPSPGuDp B WLp@p C 9 t" t :- =M^> L\$U VEtll QX=t t 5t T 5t } UBU\mhn5u@<u7};$t |t" ,R`$ j+5@$h\d5DkYlt!=dt SC~ @Itq1-PP|-Q4VW C;|͋Phh Sz['=d}}PPjht9 dR\Xu䋍Fˉu}ܡd} hn 艥$r }5\hLX]5\\d=L  l ,Q$賏=`qPPjS;=1!5\\|< 5 U;$t5|!hC ,P)$=hwD h[= PPWPH$PUP jQHۉEtUu5d<xj j<j{5d` SM9pqmmx@Džn hv 臂]NQhh PFwjzuMR5zhJ==5l@FL5l@LVhoh Pv:Whnh PvRhmh PvdDž l1du l@ltpul A uVPPjh  u*QQjh u&RRjh ܹuPPjh ǹo @WIT; A I' hs M8RRjPdjÅ8t PPjSPhh StS S7\| LQ; (S<$h\dQQj-ji5\hLG 0P8r0m 5 RR pVRBPPh1HhR vT$R  1hyG#Lt 8e D h DK1tQjSh )Džt ;t>D ӉD職dX=lJ `<2PPh1HhR }S$R ,s xu A5 EWWSVVh7h S@$2qPZYjPaDž\ VhQh Q%rXZSPPhRh SX@$pP$  =H@@ h H{@qX h GO@EpPRjS5}t:ZYQP PjV } h^h S7qVh jV|<$0ƅujjjW!@PjjW ã pjjP=d…%hÅPhh WpE@Eh 5 pV ,Q p11DžW hqS?[pqR" hq=pq lq=tq ƃ83 0RBÁ~$CQQjS $A pdi SZM* jKM=QQjhp/P{8d Dž  j5@$h\d5DZLE PP4Vh h1ҡ( j0T A Iv hx BF^8URRjPbÅ>8Phh Smt&@Bt PPjh T u*PPjh 9uPPjh $uPPjh Hp]QjPSW:~RRPS謓jjjWm R. SR(DVhBh VJlXZjWLZ `qPPjQ*$PUP jQ\EHT} \ã jfZj2$[ jPPh hXjGPPjhpM=P=A@RRShC PPQhu$~(RPWjJu8@t* S!PPjS蕮VVRh 냐h莹$ISSSN' ht4=t+ h~Bt P^=t.cÅuZY[zZY[à h+'BtRP(hP멃 h׍&UWVS111j htumu\hÅ%t"~ j^_UjE& [^_]Í[H띃 h,?ƅy@njj jPPDžUPPhpjE<$ 5t&'SPPP$@PD$SSjhk d)t3D$PMjSjh T_ukdu t$#v;1 PI PZY[Ít&hu몃C$t $dFZ j+RRh3 jC ut&` $ D$ PD$ dqCtPdqT|"$- L$ Q1D$ tP tW$Í u, RhNh((Pe뾐&SQQD$\$uW1t*PPSPPhbh((S@$dP\$ L$T$ Y[[Rhah((Pd듍v'uLÐVSS(v 1j)3 u=P$k)u$t IPPSj YA5  VÍ@hh((PVc D <Vhh((Qc uȋ 螲(vPPDvjP 1jr(&PPh3 jb@5F5r15 [[^Ã[[^Ét tBD$D D$Í&T$ t&9Pt u1øÍSQQ=t}xtpuuUPPhCQQhbh((hC@$RaP1XZ[Rhah((PBb땍'tt@1ÍÍ D$QAÉ'SQQ\$uV1t*PPSPPhbh((S@$r`PQD$[X[Rhah((P_a딍v' u à RS& ÍRD$P&Ð&SQQ\$uV1t*PPSQQhbh((S@$_PqD$XZ[Rhah((P`딍v'S hlh((j +_ Í@jPhVC=tC C T$t [X[ÍvxRRjP-C뢐t&UWVS u [^_]ËC S kT$s{ 1t*RRVPPhbh((V@$"^Pt$=-5=trsK5uBQhh((S_ [^_]ÍQhah((P^a&Whh(({W^륍&x=t2 pxkUPjjR_t&PPSRP,5&hh((j ] HPÍ&'T$tJ B UWVS P D$Shh((D$1@1Pe\D$D$^݋ 1;t$L$T$L$T$ <0\$)<(ASQWjƒ Шu1^tvD$T$ ݉D$T$w 5B;T$|v[^_]Vhh((P\ B;T$|[^_]ÉVSP&t&C t`PhRh((Sb\t"C3tPhMh((SR>\X[^Ít&'SUu5 )t,tBs1҅t9t{Bsu[øM<=(tu縈M<t́u hA < <  Шu< it[øM<[øM<| nt䍴&SPP1ۅt' @CQOJuY[[Í&VSPtW'C t`PhRh((SZt"C3tPhMh((SRZuau"  X[^Rh h((PJZ  X[^Qh h((PZhlh&'VSSr1ۋt$t>T$Cݠrt$L$:uQQPVKu܉Z[^ÍZ[^É't ;tÍv|$tÉUWVS$hVh((D$ 0j0WD$ Ń{3tn @ƒ!% ?!OlZYSPngÃtGD$PL$QUSs8t$ Ń07Gu 5=Ts$$$ 5u=@5WWjU. hh((U X$<$'5$$$- [^_]Ã\tRD$T$H9|'B09}D$hh((PUVŋD$(\$C\$D7G7F߃Vw$$Phwh((jV\P@tSh`h((jUf!V UP Ɖhh((UV h+P/D$UPhL$QD$,PD W \$,SY[PL$,QDTsu @ L$,QŒ3ZYSPdPjWt$(VD$/4$FvD$ hh((jTÃ|$ ƒ|$  Ш{L$ CK1Ƀ|$  0AG|$ ƒ%u{I t$$V膿4$D$ hh((W跿$4TÉD$ GC€}%uL$79u %AXAD$P\$ Sh$,SD$ hh((T$RTL$ 9Ƅ$  Ts:@,PPSPPhh((!‰%t u)ٍA> DuG7G LS}ZYPSShh((P胾Z@PSPgPPdqPhAh((jRÉ¡Tsu @tlqt \SlqB$ Phh((jRÃ=DɃ =D CCPhih((jBRÃaerC ,Rι$V+t P{SSRQQhPh((RG xqZPPxqPSSxqh*h((SQhh((jQÃv8x4xPRhRSg \$$Su$dQtT@$ AL$ Ƅ$ PPSPPhh((!‰%tj pSSQRRph/h((R"@$PPÃhPPj.SXG49 SƄ$J|$ D$ CyPP\$(SPPh"h((L$<!‰%t uT$<)эA58xRRVPG= hXT)t $87|$ /EQQj/T$,R#@RRPD$,P C-CPPhL$,QcL$ uD$ .!ډ%t u˃T$ )dPh]h$,SظD$Ph^h((jNÃ[@>\CPhf CPhoƄ$SSQP8D$!D$HBƃOPh h((\$SA L$DQhL(T$R%,[^_]áh I9l$H\%h~5|wD$jh~-|6D$HD$|$"`%h~ |RD$P1T$0R`j`XD$=D$(tID9|#@9}h h((W\$S?D$PPT$ RL$Ql$8D$9Uh h~ |D$L$(ƒ{ Шu [h9t$T$%)ƒ(T${[|$D$(tID9|#@9}h4 h((W\$S>D$PPT$ RL$Ql$8D$3Ph8 L$ƒ"%Psu $h~ | T$0RD$PL$ h h((D$0Pi=D$"XZSL$AQD$4D$(PD$ |?PT$R(L$0Qj)1D$KPL${QD$0Pj}Uh h((t$V=PD$PT$0R[j]Wh Vh/ ȍt&UWVSպ(D$jD$P1j)D$1+ǃ)th$Sh h((\$S;Ã<$…%~<$(PkL$ IQVURD$)L$T l$D+|$tPh h((V<$ [^_]Ív |QE"QKT$ JRVQުl$+"|$D;딍vR|$ OWVS躪D$Dut&UWVS hl$ tJq D1th1átN9|1耉ƒ9} hh((RQ:t-=>F1 u-D5 [^_]Ít&\…%uw F뿋=O8 ( WWQRCZ(P'&kht =tLt^  uC PU\ ,R蠣u 1[^_]Í&Sà jhrPtZY[PjhqStuw$%1ZY[ËtSShRZY[Ët RnPPRSHˋlPP QPPhh((P@$p8PO덉UWVS t<=SPhWht  [^_]á5>h11iuQh h((j7ň@t)=RUhWA hLh((U8-hR 5PPQPPhh((VԢ@$S7P2É$踢t| u HuUShP跕 hh((S48ÅPSh|(Pm h:h((S7-h~ 5WWVSShh((Q@$6P^É$8| -Hu(tg  €  Шt&KtF  €  Шu tt({t!uKRRQht9  €  Шt;C9  €  Шu tUWSV s뺀 hFVSP1tY%C t`PhRh((S6t&C3tPhMh((SR5빍t&ueu$1  Y[^Sh h((P51  Y[^Vh h((Pg5hldUWVSLHM$t5wЃL[^_]Ëց}Ã& ƒ  Шuك#Y 1Ɉzt+u h/=|-ށ=nD$, D$ D$$D$(|$ 1t |\z h~|fj 9 -\@Pj|$HWV Ilj =T$@D$,Ћ9|7с9}h h((Q Qv2L$,-)ERRWS裢D$@1D$$l$,1" D$( ؅D$(tPh h((W2& 1t D|$ '%!5ƃJT$,,<Ã> ب= t="ihT$|$~l$|(-tH}e=t}{P7)( "<>% 9&t h$-|#>ƒ&t h#=|#<ƒ>%t h#-|#>|t h#=|q#>&%t hC#-|2# Lh>z=h)D 5( )h~=|  @u>ƒ<%u ( h~5|Rt5@* Ȩ+ƒ? Шt!k$< ȨH>?T$,[ÁtO=t6=#t<= =}) (} t pu  |$,=zt h | VЃ $|$( σÃ|$( بtT$,BT$,\$,= ;C١A\$,9+9}h h((RR, &5hH1)D$ h~|D1 thBhLƒ` Шu"Ãtz@tD$ D$$xvÃ(G{ƒ[ ШT$($$h~|Ph h((j+@$$@L$,9|59}-h h((RUH+PPST$8 1Q聛 |$0D$,|$0h h((Si(thtBhL[ P h~Bh\ $'%" h~ |o -r9 4?PBVL$H؉QSE=OƉ== ' \$HSU|$TOWjPh h((VS* h h((t$HV )^_h"SU D$@D"L$@QT$@D1h h((S)D$PPj$W~O|$,L$,;|$,D$T T$;=D;QQ PS;KT$,L$ L$Lh~|(hz=hLh~|T j9 (S-j\$HE(S-j)>Jlj=T$@D$,Ћ9|6с9}h0 h((QP%l$,\D( UUWQ輕l$@\$,tRh5 h((W%1D$(0Pj[L$HQj]Z=P==- L$,D$, T$ SGT$,L$ h~|Qjl$H[Uj]=T$@D$,Ћ9|6с9}h h((QP$T$,C-PPWU=L$@˅\$,VUh h((W_$1===# A h) h((PQe#'i hP -h((UR2#;"){$- " Ȩh~=|-\&5ht=vh~-||1t/ u 7h)ZhD 1 t%1ۃ @CRbHu݋5 5h h((hR!h~|-  L$T$1-1ƒ)t:  UUW=WW1vƒ)uơtRh=h((P!L$ߋl$ -1t,t W蒼à S$Z|$@t" } ULD$@D$,\$@؋9|7с9}h h((Q Q T$,=:=D(tPPUR5L$@ˡ)C\$,DQh h((UhI-M9/A hj h((PRg&|$ F7!]Phh((j5hXpl5 t0XPHh tM =Wlhtռ-hl$M~ t$|1QQ=T$8RW; |$0D$0L$411  =A=|=r=#g8=@uhh~ |tQ|$( |$$uG*n)N(\ S ESh*h((jT h+h((T$8BR:ZY CQ;Wl$(t CCt$$t kk  WW=QW<tySStK#t-}/)(}% t  t;t |Bw꡼t tkk{Á z}t`sB`s5ȉ4  Ш = }d}o }i}t$}} }J}  }d6}{}{B t5}-}p}xj5)=(=h~ |-x-x}iP}nF}< 1(1k)C t`PhRh((SS+tPhMh((CP$}-@-|{&}o }t2Qh h((PhltRh h((P  t W襅;tKr1=Fr8uUURWzuڡpr\  h~| ;+:{e8,>LM<=$- Ȩ Шu) ȨD h=jWPjbG [^_Åt SzÅPSh)Vf h h((S PSh* S=1=jjRjFPWVjF 1h =ht5Nw?PSjj}Fá6PSjj^Fá VVxÅPSh<*Re h; PPhVee Ptb5XÅPSht*Pe hx h((S<$Qy4$w1[^_Ë :=1B~u1B΅jPPh* PPh*Qd덉Åt3V5Ph+Vvd hd h((S<$x]RRhP+SCdސSSS=t ZY[Ít&PSjjDZY[Ðt&SSSá=t =t'ZY[PSjjmDá=uPSjjLDZY[ÐUWVSX<VDžDž DžDžDž׃f \ 9)΋F''~ Dž'C)č|$PV QWq)ċ|$󥋽 t\ |9Q "tD:Z=(w  Yw 9 ~)ЋNjLwP$%`sROQG؅tt RPIZYPWR=;`s~H`s))AQ yf=Ywf9 uDž;  "=t@=Ywf u`|&t._9tA=hte[^_]ËhtR ƒ  ШtA= uhtJ 1 719`KQ.W1B)C t`PhRh((StJKtPhMh((SR`u^u?  E警3$Rh h((PEQh h((P/hlkİDžDž Pj|PWR56DžDžPjQP>HW щH?  GJ ȃBoGJ ȃBRGJ J8QQ Pj;PWR<5G8Pj&QGP5PhQWR4GDž @@RW> I uIG8oPj&jGPt4 Dž @@Q=Ju Dž @AR=HuDž(uPhPOQ3UDž;FDž 7*Pj;ROQ`3 Qj;PWRC3G8Pj&QGP3PhQWR2PhPOQ2G8Qj&jWR2_RPPjQ18WGO"QQjGP7PPROQ7 Dž @BQ;HuPPGPR.1{PPjGP37`QQROQ7DG0PRGPOQT7QRGPOQ57PjRGP7O RA8 GPw5POQWRGP6tPOQWRGP6TQjOQWRy66 GP>HHWB ‹u W| xPQRGP= |xQRPOQ=|xRPQWR[=h`sQ QWROQ4`s7H`s,P`sROQGPF4`sH`sR`s QjGP 4`sH`s `sRGPG؅tt RP贓ZYPGP/`smH`sb `sRGPjhi,$-ZYPOQU/`sH`s`sPOQjh,$-ZYPWR/`sH`s`s QWRjh+$<-ZYPGP.`suH`sj `sRGPjhq+$,ZYPOQ].`s"H`sPRGPOQ/`sH`sPRGPOQa/`sH`sPRGPOQ+/`sH`suPRGPOQ.`sJH`s?`sPOQjWR,`s H`s`s QWRjGP,`sH`s`s QWRG؅tt RPĐZYPOQH,`s}H`sr`s QGPG؅tt RPqZYPGP+`s*H`s`s QGPjh&)$*ZYPWR+`sH`s `sPWRjh($K*ZYPOQO+`sH`sy`sROQjh($)ZYPGP*`s2H`s'`s QGPjh.($)ZYPWR*`sH`syPPGPWR0\QQOQGP/?2%WB &‹uW Q7PGPWRQ1QjGPR1W‹u GobDžKDž4Dž RQj GP}4QRj j\4 RQj j;4RPj OQ4QRj j3uPjj GP3OPjj j3+Pjj OQ3Pjj jd3QRjGPA3@B RQjj 3@BuRPjOQ2SQRjj22RPj OQ2QRj jr2RPjOQP2QRjj/2RPjOQ 2QRjj1iRPjOQ1GQRjj1&RPjWR1 @A QPjjS1@B RQjWR1QPjj0y RQjWR0VRPjOQ04QRjj0RPjjv0PPWRQ#PPjPp#ht q95lQu=(PhWT@  踝1~w15td1tS1/tU%C t`WhRh((Svt"S3tPhMh((CPRt2Qh h((P)hltRh h((P  PB J tU%C t`WhRh((Sft"K3tPhMh((SRB   j;1t1cQj&RP0Rj&jP0Rj&jPh0Qj&RPW0Rh h((PhGQh h((POhl'UWVS,Hx=$D$|$t$H,t t-\$(L$ T$l$$=Shlh((j  j@Ph踊C=; K1tt4RRVPPhbh((VWS@$PXt$@51D$Dt 1x=(t< SSV5VX1<=(uċ l$|$L$ D$T$$\$(-Hx=$ ttD$Dt߉6t ,[^_]Ë-}  Yk{Kl$|$ {k 1t*QQWRRhbh((WQ@$$PWL$D$ - ={K=Qhh((S1ߋ-O <%C t`QhRh((StXS;tPhMh((CP[빡QQjP_C V{,[^_] -t  VVK5du@ jRhah((PUhh((kUeT8=t. pxkUPjjRQPPCPR+Wh h((PRh h((Phl j'SPP\$Phh((j HC HP tKS HxC$KSC$kt@u0C K$ tC(S,K0ZY[Ë@tɃ PC 뿍Phkh((j4~Ã1ZY[Ít&'VSPt$VNV F^ tNVHxh $}Åt@t@u`&F$V,N(^0 tX[^ËZJP hh((RH PF C듍vWVS@\$P$Qhh((j JZD$=x HtT$D$= Hx$|$L$ T$$D$(hgt @vF =  t~,F$V(N0hF?Džt,PPWPPhYh((WK@$xPWQPjh SPPh[h((SK@$CP"QPa&$T$NV ^F tNVhHx $WÅt@t @N(F$V,^0 QQWhFt]tRh_h((W= t[@[^_É@ P<D$ qBJS hh((RF@[^_à PF C)D$t܇vËd؇ÉUWVS\$111 t €  Шt Cu -1Ҁ+ tCt8 t2QЀ w*׃0Cuˍvt؃[^_]Ê 돐&WVS \$0t$4|$D$jj VS薖O0jj VSvÉЉ uQT$t#;ut$$t \$$;k [^_]à 1[^_]Í&'WVS|$ttL1҈ڋDPu _t1[^_É_wu [^_pL1ɈJu_uFuҍvWVSt$Fuڊt0< wBuWWSh+71[^_ËD$tPt;tKDQu<_u{[tK1ɈJu_uGu[^_ÉS\$ tt/tC uɸ[1[Í&'UWVS 1:K1ҋ|$ ډDPu_tT$$[ 1Ҩu2t)=t0[t/J1Ɉً(DMu_uF7u1҃ [^_]ÉPPVW1ҍH<8]uۉȀ<=t1͍S \$jjSfGx1u ZY[Í&RPjS;G‰ZY[Ð&jjL$QGÐt&hh+&Gx PA Í& ,QyA$@tRRhPFUWVS$$tUts_EU11D$ u#O\GXu\}X11 u D$ t&T$ [^_]Ít$pPV$PjrE1҅uՉ뉍t$UV$SjPE1҅uh&UWVS D$(l$ |$$Xƒ%t*t$PVjSE@tKuڃ9%u [^_]PPSUDÃtt 5(V?9t U@ [^_]A~=J@6v'UWVS 1|$$l$ 9},\5 t#G1҈ڋfP% u@tF9|1 [^_]ø&'Sh1ۉRQD$xPjCuT$@t؃h[óh[ÐVSd1\$pRPSjCuT$@td[^QQjSufᐃ T$D$t8/tQjPRQQPRRhh+P1B@$PGÍvSL$ttCڅtPZY[À.uS/ Ȩuˉ멍&WVS|$ hXÅt7 P@ƃ~$PVWSAu 7€/ Шu[^_Í7PhShD~[^_Ð&WVS1ɋ\$|$tc S^@19}OхuOΊ A <:%u9u=<3tNPhh+j[^_Ê:%PQVSr؍t&SQQ\$ +tx-A< v+€- ШtPK0 wE SYt5RRPSShh+Px?@$PDZY[Í&1ZY[À{u h+g멐t&{m h+I닍& 4 @|@Ht Ð j+@+@$ DS@+@ Í&WVS=T$1t$t>~t V=[^_É~"t&"t]C €/ Шu:t't<~؃\֍vuPPVSShh+V=@$yPXC1ύv'WVSt$>~tZWWVSShOh+V=@$6PCƀ>/t%QjVj hUh+V3؃[^_Ë=>~t V=띍&~"tZC €/ Шu:t't9~؃\ָuPPVPPhh+V<@$fPEB1ύ&VSSt$95pq95tqt.1҅19} 94B9|1҉Z[^á h1h+PPZ[ ZPQ9uypq1ҡ9} pq; tB9|9tI pq9 <1929 tXB9|#Z[^K D; } L Jpq@9 pq&'VSVt$tt^[^átXd 1P£9}* PP1RPKC9|օt뙡 h1h+PSZYP P7uqpq1ҡ9} pqt&; tB9|9t> pq9 199 tMB9| L; } L Jpq@9 pqt1^[^É'VSVt$ttZ[^átS_Qhh+P1҉9}B9|tZ[^á h1h+PRZ YPS56uo pq 1ҡ9} pq; tB9|9t@ pq9 19 9 tNB9| M; } DJpq@9 pq t1Z[^ÐjKh+h\  <$jLh+h/<ÉVSV$t$~sP$>t:QQVRRj[h+VP7@$PtFPPVPPj[h+V5@$;P;CPPVS[^Í&Pj^h+jCPPVSy[^ÍvPjWh+jl&VSPD$t$D$$D$P $>t?PPVPPj[h+V4@$mPL:CQQVS[^Pj^h+j:CQQVS[^PjWh+j vv ~$PL$D$B Ѓ Phh+j‹L$D$B Ѓ ÍS \$hh+jT$ X@@ [Ðt&S hh+jKT$ ÉPL$(H D$$ Chh+j X@@ [Í&'S hh+j D$L$ CT$D$KS Chh+jX@@ [ÐS hh+jk D$L$ CT$D$KS Chh+j3X@@ [ÐVSR8$P$4;twPPSPPj[h+S=2@$P7FPPSV.Ëp2p~YP XZ[^1Z[^ÉPj^h+jQPjWh+j8RQhh+j뢍&UWVS 1T$ $D$D$B €  ШtvC €  Шuɉ€; C<;u19E  tPh5h+W;uShFh+j=D$8CD$CD$'C $ t$$ Cs|$,WK7 hh+jX@ @ [^_]Ã1$")PWjVbEǃcD$SD$EPPh4,L$4Q" T$$j]Sh+t$4V"1 [^_]PPh,빸uFuFuFv'S h]h+jËD$ Chh+jX@ @ [ÍVSRRt$hih+jWT$(PD$ Ctu:C Phh+jX@@ [^à Vq_뺍VSPPt$hxh+j ÅtuT$CSY[^à V_C؋T$SY[^Í&'S hh+j[L$ ÉHT$$PD$( C hh+j*X@@ [Ð&S hh+j  T$PD$Chh+jX@@ [ S hh+j { T$PD$Chh+jQX@@ [ S hh+j  hh+j   CC T$ HPC؃[Ðhh+jPL$ T$$HL$(HP T$,PÍ'S \$hh+jW1҅ۉX @ @tSPZY[Í'S hh+j  hh+jCP@ @C C؃[Ív'UWVS \$(t$ |$$tvt5k}~LP 8pE [^_]Ét‹uCh ؉*s~ [^_]Phh+j(Phh+j hh+jCP@ @C C& UWVS\$0K ƒ%tPPQhd,@[^_]ÃD$D$T$D$ PPj|$toPhh+j]à sD$,t$(C shh+j6X@M@ A [^_]ÍFx ;upFy>toWVS|$\$!Qu=PKPh1փu[^_Ðt&WVS` h-Åt8u `[^_ÉPPj+jxA$=__Xj-jxAtΊt1ۋ=P9}(&`Ct9ƒb%u߿t;Nƒb%t$`GC>t >ƒb%uƃ`ShZh-Vӷ0t&'UWVS \$,l$ t$$|$(> Ȩt^tJSUh(-=(W_9ttPhxh-S[5(t$ [^_]ZSUh봍& Vt0 V낋(QQRPA$!!P VLPjjV/7t&VSPD$\$uZޅt:Nt;ubSM<u=Ph1-(Sb6uƋ5(D$ t$^[^!(PPRV$h 늃 StK SÅҸM<u=P(Sh1Phh-S6l SuM<u=PSh1.QjjS ÅɸM<u=(PSh1Rlh넍v'S (\$QP${C (Rh6-Q!XZjC Pl[Í&S (\$QPK$+C (RhA-QXZjC P[Í&(RP$ D$H(RhO-PÍ&UWVS(@L$8\$,L$t$(l$0|$4RP$z(Pjjh[-&# u<tT-(D$(l$,D$$D$ _- [^_]"(Sjjhd-"uVE-(Ph$UX5(ZVu`g-t&Py(PPRtF?t?P u(Vh$SV^ (_Q|$tD$8ug-띸g-뺍S(PPp$P(Sjjhj-!\$0 - M<u=P(CQh1Ruϋ(Sjjhn-![ PLÍt&'UWVS,D$Dt$@D$ VHÅҍ@ @;Dl$D$F1%D$%tCHC @;D RSWP=@߃=@tuH5@2,[^_]ÊsFd%hcD$T$T$8hh-DPR蜰£HS@QDhh-R1ɣH@t&hh-DPR4‹ @HS@WDhh-Rr£H@?stQRRPhP.ZD$T$T$xUj |$WRQǾlj<$|$\$|$ ;WaD$%Sjhs-\$S WVSËpP@ 1w[$. QajVjj{7VXZShv- hh-St[^_ÿFPs-Vu=Ph}- SRC8Wh1뫃tPPRh9yWWSh-gՃ h<XƅPPRh-?뭃tQQRh9+PPPh-W6VRh-sP>WRh-_PVRh-MPVRh-;PSRh-'SQRh-tPPRh9PPQh-tPPRh9hPPRh-VQQPh-BSSRh-0WVRh-PVRh- wQQRh9s KQ ƅP-u=Ph}- hxh-VAPPSPhv-PPRh92PPRh9ss<&WXV1S1Åu5t&u {tE hM<K ƒ Шt S&tqƋutE hM<r hUu WX[^_C 4C NljE WVS@t$^$QM<u=PKPh1׃u؋^ u[^_à hM<F [^_SRRupCtzC hM<K XZRh$M<[t hd-yCu hk-aCY$-M[X[ÍC8 h-똋C& h-PPC Qh $M<[huPPC Sh S\$h[-D$ [VS@\$h/.'vQM<u=PKPh1փuD$sY[^H&L$QPh-)Ðt&VS \$C0VhA-@[ $QM<u=PCQh1փuX[^Í&'VS \$C0Vh6-@[ $QM<u=PCQh1փuX[^Í&'UWVS ŅBTt6HTEE $.&L9|0ƒ9}hbh-RPɧ1 K B =WEa h-EE h-jE-jPjh-] u [^_]à hM<1E [^_] hd- h=뵃 hk-Tu@TFx$-w}VVw@ShA-_ )t&QM<u=PKPh1փu؃ hk$U_L9|1ƒ9}5hbh-RV1 K B  S=$.L5sGLd@~=HL&À  بu h 5Ls)hU5LmL9|0ƒ9}hbh-RP#1 K B R=gVVhgh}TCGT`UB |_&P;dWWB Phx.E@)uSS^1Rh ._XZjh 1tL9|1ƒ9} hbh-RQ1 K B R$.[PL s@ˋV PRLƃ> 8:UtLPs)HLP{ hUaL9|1ƒ9} hbh-RQ1 K B R= .{~ VOz]WWh:h$TBCT>@~5HD<&<  Ȩu hm h#.]L sʃCLL=s@)҉L~5HL&À  بu h hUL9|1ƒ9}=hbh-RW蜡1 K Bu \B]h(.\o5P =TG=TCP @~=HL&À  بu h hM<$D\J\u ^h/.@$Q;M<u=PCRh1փu؃ hs0 ]h[-pf hY }@h+.?_+&QM<u=PKPh1փu؃ @h_ $QM<u=PKPh1փu؃ @h_$QM<u=PKPh1փu؃ hsw$UkL9|1ƒ9}5hbh-RV 1 K B  S=$. L5sGLp@~=HL&À  بu h 5Ls)hU5LyL9|0ƒ9}hbh-RP/1 K B]VVs>Wh- C Lǡs‰L hUL9|5t&ƒ9} hbh-RQ芝1 5K2 B Sf==v@_$Q2.u=PCQh1փu؃ h= sLʃGL 5Ls)hU5LL9|2ƒ9}hbh-RP苜1 5K2 B  Sf=?f=Ls)׉=L hU+L9|0ƒ9}hbh-RP1 5K2 B  S=$_PPh$h]WWh4h$=TGC=T@~5HL&€  Шu h< h#.,sLƒCLL=s@)҉L~5H\&  Ȩu h hUL9|1ƒ9}=hbh-RWl1 K BE uh6.L TAF T@~=H\&€  Шu h h:.L=sFLrLsN )ЅɣL@~=H\&  Ȩu h hUrL9|1ƒ9}hbh-RR'1 K B  Q=A.sL‹F Lx5L=s)5L@~5H\&  Ȩu h hUL9|1ƒ9}=hbh-RW61 K B  R=!SSh!h}@_(t&Q M<u=PCRh1փu؋w ` hM<G 5C}VVw@Rh6-v_ $Q M<u=PSPh1փu؃ h9$U-L9|1ƒ9}5hbh-RV1 K B S=$.FL5sGL2@~=H\&  Ȩu h_ L5s)hUL;L9|0ƒ9}hbh-RP1 K BSSh=hqQQhhX== h-EX TA TQQh$.hWSSh$.h>VSSh$.h%1 hU5Ls)֡5L9|1ƒ9}=hbh-RW赔1҅5K2 B  Q hU Ls LN~ F AZ QQQhG.?&uEP hM<T@TPPh .h hUL9|1ƒ9}=hbh-RW蛓1 K B Pw=DPPhDhVvSShA.h=B5Xt;X=Pt hU| h-m hM<` h뽍&'UWVS XL-sD$ @t 8j hK.|$(CLs PA.T$4 Pu(.P@X|$0WU1> LP-sKP$ hUL9}q1 K B R= .=~ T$(Hu {  V[^_]Ã9}-hbh-RU6Y hU,5Lsƃ5LF~ F @LP-sKP hUL9|1ƒ9}=hbh-RW胐1&-K* B  SW=DPPhDh6RRPh$!RRh .h\{PPCWP9g' X@D$`H Í& X@D$0 HPPQhÉ' $L$RQT$RPÐSQQ\$uS 9$}g1@@@@@@@߃U $A $XZ[ÉRhh /Po 9$|Qhh /SNXZ[J낍t&VSPt$t]t&6C w4$@/Ph/h /CP  SR&PhBh /Sߎu[[^Ít&VSSt$tb 6KQ9}F1@@@@@@@߃2@uX[^Rhh /SNJ륍SSS\$t)CuBCu-C uQhh /SXZ[à Pڃ PŃ P밍&'S\$SRXC PCu XZ[Í&Qhh /P菍XZ[Ð&S\$CPXK QUCuPhh /SJ[Ðt&Rhh /P/Phh /S[ÍUWVS |$ G t^ƍt&6C w4$/Ph/h /CPɌ SR&PhBh /S蟌u wH$/G PRk j[h /OQhPhh /WT [^_]jPjh./:Ћw ^SI^ * CPFXSR jmh /UuPjoh /Vx_ CPZSRXk U hh /S誋=o ]Su 6C w-$0Ph/h /KQa SRrRhBh /S>멋_ kUJ^s VPZKQ j>W_ kUXsV h1_ sV^S RKPh_ KQ]sV j{o ]Sr jT_ CP h_CCC utPht_ sVJK XQ@XSR6]CP jL=Phh /UtPhh /kUȉ P{ Pfc PUGVSSSt$hh\0j7Å0u @Z[^Qh h\0V CVjPW؃Z[^ÍSQQ\$CuPhh\0S[Rhh\0PPhh\0S׈[ÉVSVt$t1ۃ~F<u C9[[^à SYVC9TtGu= u#t) t( t# tÉdtԍ&ËJAÍvS\$jSZ\$ [v u à P ÍjD$PjÍt&'UWVSL1ŋL$`T$,\$dD$;ؿD$ )щ))Éʿ |$ 0gfffT<0O|$ )ʉхu͋T$ B|$@:BH .F|0u.mF gfff))ÍC0ӈD 0IuݍQvL$@< B_.F|0uT$,tD..F2T$hPPjWyÅx+PjPl$US$~ |$#40 0W%~[^_]ÐPPjWÅx;PjPt$VSG$1t~PPVL$Q譥l} \I^T zT@t P jOd0 U躱ÍHL$^sXVU腱Ɖڅl,JuL~|$ 8-\u[ =Wl$5$-5XZjhPPWh a;|VWhQh\0SZ}y jhQQj+jreK@6t&RhPh\0 CQ};|눀|$!9}D$ C9}D< <  Ȩu\$9}#L € %t tC9|USl$U\$Szۉ0QtKPWh0tRh h\0SS|~:PPWh~ =뮐t&VSQÃt$PPjSxy~ Svt't&PPjVTxaƒ Шu,[[^PPjj-yVjjh2/[[^à VGPjSh2 qPjVh2댐UWVS\ŋ5T$XD$HD$ td @U5\t >tdH5HWWVSSh h\0R@$yPod*:=HD$LÅ%1Ʌ)M1*1ۋ5Xv|$Xƒ|$p Љt$@D$D5,vuD$ttƒ|$X%t |$p$ E D$xut*1SBtJɰJu uVD$dD$T h0I5pZD$<D$8EuC@m T$`BSND$HL$Ht5dJ&PPT$\RhoH!T$Tt ؍v‹uBL$T0t$PqL$D%T$3…1Ɉ(v… |$t|$3ty} |$XÁt_|$puX h0P… 3Ņt蠋 U|$Xt|$ptKVVL$|Q D$8PPPh h\0t$LVi@$tPP.8T$tT$x>D$x1ۋv*t$xN<SC9l$Xx |$dWWt$px \$|S?yQQh=hFVHHL$L\[^_]Ít&Qz )ȣ Rh h\0Pu&%=NA8%] l$D\L$tt1Ƀ|$Xƒ|$p ШuRRQj,`|$Xx L$dQ"t$px \$|S w1ۋT$DQQh=hFTHH$ك\[^_]6 HHRRT$|R SPPh h\0Q%@$rPP+ED$D@ED$x|$Xƒ|$p ӃɃ `SL$x1ۋBL$xA<uC9 ST$xJCD$x9ƃ ]ScD$ddPPjNR 0@&SYRl$t0u0 \R'Y|$`WЉD$\D$PnQQPhF*Sxl$ xtWh h\0\$,Sar t$`V$0AL$\\PPj\$`SaPPWh82ƒ|$X%t |$pVt$Xx D$dPL$px T$|RiIuSh4h\0Uq 5\V,D$LP[ SVC9y |$X%W (v9SSjjN$5ZYjjM$5 jP ֿ08aWt&T$pD$Xst$tht hD$$`tPPjL$0Q CT$tthVVWh0$T$pD$XD$pD$X5,v t$`NRD$LrD$H~uWWjM QkB~|$<@ Bt h0>XZSh>D$<&WWjVT$dD$LZ$R|$<`h  t h0>t$ t}5tE WR"ۉD$d =H%P l$,1-D$$9$t  GPt zz UV$RjhUuD$D t W  G%t w_=|$DPPjKQqQ @ d j&t w_=-\/.Ctdt5) C@Pd%PPHPVV5Hh_ h\0V-@$^PdF=HJ1-KWZr UU-@USC ;W4tP @dWWV+US1PUV$P$%D$4 &PP$Q$PY[$Sj0XZ$XRj_Xى؁%$GUV$UjW_$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$S$SY^$Rj{XZ$Vjj S$W$Wv $Q$PWx V$XU$Rv P $Q$VSjvP$Vv $P$UV0x $ R$`Q$P v P $U$RSvP$SBv $Q$PSw SVW^vƻ.1|$x;;$-($l$t|$p$$$$T$dL$lD$hl$`|$\t$X S…*Phr@h\0VR[ʼnD$P<%t6\$PC9|@9}hh\0VU[ŊT$PG*\$P뼊WtÀ%vPGD$TQЀ wGXЃ~lER€E Ш US L$\QD$dPD$\P$ \$P9|@9}hh\0VUZQQ$RD$\GQ\$Pt$PD5PUh?$S^$W; hh\0U[D$|-PPjU-,$u t PyTjPjhH1蓹}9 PȤ $XQ$0 hX1)G P脤$XP hX1)K S ‹$t % h302Åj1\$PGC9|@9}hh\0VUXŋL$PG)\$PP?G|$X'~D$X'D$XQL$X)ʋL$X)ٍSRj$T \$P9|@9}hh\0VUOXPP$QrUV$U$P_-D$lPL$tQGD$T=JF tt PP F P KQ"pDžSS$PwRb<$É։-@$ %D$$Rh^ h\0PW-|$$Å jBvtDŽ$dGV_ _UV$VjWKsBk D$H UYʼnD$Xh)&XZUhe&t Kyy1 S@S茭5p\t 8tdhHPPRPPHh]h\0P@$SUP2d=H%tBT$L:|$L;51Rh h\0PVQQ\D$THRt$TV6P@ KQdƅuTt5:H,\$D UI $)%D$$6Rh\h\0P3U S貟OT$dRD$l[SSj~U2V}PPjMQ%Å PO9D$ SXED$ 0vR-D$4D$$iS%=11DŽ$9 P00UWVS(ʼnT$$h Y't @D$ h 3'@PT$ h  '@HL$ ]S"DžtD$0t ppD$< h1 QjUR[o^XjhPrY[jh$XZjh$^Xhh#Y[WhSXZjhh#^Xjh#$ -h&$A1ۃ jBh 1jCQD$t*Eu$ PuD$< jAt#LuL$<6 jBt$t)Eu#-PuD$< jC-h =@uV&tX-hPuVjL$QuZ SjT$ReZTwtd_Q t t <JA6@D$ h |$ID$ h [$QD$Uv jB> 5jC: jC%T$ jAr SPt$DV]Swl{PPSPPhZ h\0S蕷@$LPYXShP |XZSh@ o&SSQP[ PjT$RX h h\0SLXZjD$$(UHj5H_D$<|$5FP5Pjh45HT$<Hjj|$$WWTPNRRjjL$(Q?TP6RPjj\$ S'TPR-t hu j"[^_]à l$$uVn_D$<|$SSjT$DR? D$D$0xx h1@p -H… Шu\PPVPPhf h\0V3@$IP葺Y^PhP XZSh    |$@WjjjL$0Q  aOAUUL$QSShq h\0T$,R蒴@$IPXZShP y^]Sh lt&VSj $1vXZSh9jjSjT$4D$0 ƋCu)Rhh\0SI$1\[^Ít&Phh\0KQIRhh\0SxI$1[^Ít&UWVS 1ۉՉD$|$4|$ hl`L^(t71 +t&F93~!C<0t V葯S2F93ߋD$(T$,PPjUcu*\$ PPjht5 j &_`|$, ШWWjt$DVT$D$0=t P̵f jL$DQW|$TWT$(D$DPσ -U葵'UWVSǡ@T$D$tW |$0 G1҉? Gt$T$Gt0 dl$t|$u|$,D$ t7T$,ҋT$,ÁÉ\$ |$ Á|$ D$|$ ~KD$|$ c~4$…t GG $DQ$DRU\$SWw Åx U譞Pjl$Ujۢ؃&D$A AP ÅvN …%utFt xx ^SaX&i1F?Uѡ`M(vtv $DS$DQ$DRjUCËE tEnEt xx $DS$DQ$DRt$VuUvFx |t$WBt HH SFPUL$QBP x U̜l$ NQ蹜SwRhh\0S5$1_{?vGkx |a V薞3$8T$9|B P Ë$<QSRHQjXSD$h1YXShXZShzxPPUhfPPNQhSXZT$RhB$WUhh V$DR$DS$DWjVyNOPhh\0CPh4m h 2LVSPPt$h hd4j21t*PPVQQh hd4V/@$2P荣SCD$C CCZ[^Ðt& qt +q ÉVSQ\$t$Ctnt@tu`CD$D$X[^ PttVjjKQsXZShО hhd4S3X[^à sVot CPMmXZSh膞 h봍t& D$@t@u ÃjPj;PhE ÍSQQ\$StDCuAu,PP Qhp4YXjSD$ XZ[PPjS1U[X[PPPhӝCtNjCtjPj螞Ph訝렍&'VSVt$1ۅtt@t Cu[[^à CP1'WVS1|$t80PPPh$8CtSu Fj u[^_Í&jKQjPh뽍'D$Ít&'D$Ít&'h8D$ PnRu8< jD$ ÍVS\$j蘚 )Y^8<RP.?ƋCuCsCZ[^Rh8hd4PO0CsCZ[^Ív' jj jL$ Q赞@uD$ ÍSPP`u9 u@&imNA90Љ%9tu[Z[蝕 uj虙@  VSP`t$uc u@t&imNA90Љ%9tQQuQ@P=ËFu@V^VZ[^ Ëuj@ uRhhd4P.V^VZ[^É' T$t:u $D$$D$ PPD$PROt̋$D$ Ít&'VSP\$败VVRP<ƋCu sZ[^ÐQhhd4P.s؃Z[^Ív T$t:u $D$$D$ PPD$PRCOt̋$D$ Ít&'VS ‹\$RP6<ƋCu sZ[^ÐQhhd4P_-s؃Z[^ÍvVS dd\$PVVhhd4Qq@$+PϜƋCu s[[^ÉRhhd4P,s؃[[^ÍvVS\$ rs^ZRPt;ƋCu sZ[^Qhhd4P,s؃Z[^ÉSQQ\$u t CY[[à dxPyCY[[Í&'SQQ\$t ;tRhhd4P,t&PPSPPhhd4SC@$*P衛D$ [Ít&' L$QjT$$RD$$PwD$  WVS\$T Pi>XCPm24$襜{؃[^_É'VSV(tD$Z[^à 1ۍD$ P P҃.V [^_]ÅokF@u tNuu1ƒ W=1벅ttSŋD$FES5Su] ]?It [^_]ÀFuSuu UU֍&UUjs=V<뒃 j{C%RRL$ QPPhphd4T$ R @$PiE:VSD$PaÅt@t^[^-Sƅuss؉s^[^Phhd4KQH ՍvVSVT1ҋt$uu\tI1"PjCPVQ1҅tPЅu[uډ1t J ЅuCtQZ[^Ë `tt& tRjPV1҅tPtJ Ѕt Rу벲bSS jSRT$$Z[^ÉWVSt$|$ u`t5t&CutPjSRVht H[uϋ D$CD$[^_RjPV$tXtCQQWRRh hd4W@$mPLKCEPh hd4CPoC"QQjj5ã @$ƼCD$CD$[^_PPh hd4SR9t&Sj \$SL$(PQU,ZYPh1hj SD$<RP5,Ph1G([ÉVSj D$PQQu^ZRP+ơT1҅uu|tn1&PjSRht4荾1҅tPЅu[u։1t J Ѕukt XXPPVht4pp$[^Ë `t {RjPht41҅tPYJ Ѕt Rу늲6VSVT1҅ut&1,PjsVhX菽1҅tPЅu[u։…J ЅpT1҅u tu u`t 1+t&PjSRh+1҅tPЅu[u։1t J Ѕ,t-@t'Xt jjhS@~t dtlt& hy4;Åt6QQPh+ PPhthd4SVVjh+vHH[^Ë `V CRjPhX1҅tP!J Ѕe Rу\1X RуRjPh+艻1҅tPQjjhVQ? Vm;XZVh+ppt S?;v'VS0\$Uh hd4V [^_]à 1[^_]Ít&'VSVtpu 1[[^Í&Sh hd4j N Íh hd4P2ZYsCjST$  3h hd4S([[^ SPP\$hRjPS{2ZYPSi[Í'SPP\$L$)‰u PPQS`eZY[ÐUWVS 1ۋ=tPtJˋ@uu 1ۃ [^_]Ph hd4j 6 ƍh hd4P^ʼnFtUU1ҋCjV[u.Wh hd4VrhRjVUf1ZYPUh [^_]VSVtpu 1ۉ[[^Ðt&Sh hd4j n Íh hd4PRZY1҉sCjS 3h hd4SHthRjQV0^ZPSggD$@  VSVtpu 1ۉZ[^Ðt&Sh hd4j  Íh hd4PZYTsCjS 3h hd4SuthRjPV/Y^PSfd UWVS 1ۋ=tPtJˋ@uu 1ۃ [^_]Ph hd4j  ƍh hd4P^ʼnFtPPTCjV[u.Ph hd4VohRjPU._]PSf [^_]Í'D$1ҋ@utÉ'S1ۋL$Qu t 9At[Ãt[ÐUWVS 1ۋ=tPtJˋ@uu 1ۃ [^_]Ph hd4j  ƍh hd4Pj^ʼnFtPPVCjV[u.Ph hd4VLohRjUS-^_PSd [^_]Í'UWVS 1ۋ=tPtJˋ@uu 1ۃ [^_]Ph hd4j  ƍh hd4Pz^ʼnFtPPVCjV[u.Ph hd4V\ohRjUS,^_PSc [^_]Í'T$1ɋBu t9Btt&ñÐ&WV5StFt9Ftvu h$6OS1[^_ÅtFt xtFu1[^_Sh hd4j V Íh hd4P:ZYX{FCjS 3h hd4S1thRjPV+[_PVb[^_Ív'D$1ҋ@utÉ'UWVS 1ۋ=tPtJˋ@uu 1ۃ [^_]Ph hd4j f ƍh hd4PJ^ʼnFtPPYCjV[u.Ph hd4V,ohRjUS*^_PSa [^_]Í'UWVS \$ t D$ 8.D$=1ۉtPtJˋ@u|11Ʌt &Au… 1Ҩ q1V)1D$~T$ÅuFteL$ 8uPD$PRL$,Q#auQQRPPh hd4FQ?`@$Pe\$Eut$Sh hd4WT$ [^_]D$xD$x P_D$PPRPPh hd4FQ_@$Pd\$EuTPh hd4j  ƍh hd4P^ʼnFtUUTCjV:[u.Wh hd4VhRjSU(ZYPU1_ 1 u PjRD$P试1҅tPЃ Í'W=VS_t$tLQQVjS] 9XtfV V9XtpY ӉYt$[^_t&;= tp j^ÉGQQVjS 9XuVVY ӉYt$[^_PPVY ӉYt$[^_ j뎐WVS\$CtP tI=wtHPPSjVl 9ptFS S9pt>q ։q\$[^_#;= t0 jqƉG뜋SS‹xxS봃 j΍t&SPPT1҅ut&u_tQ1&PjCPh3轓1҅tPЅu[u։1t J ЅuJD$XZ[& `t tRjPh3f1҅tPzJ Ѕt RуD$XZ[T&M'SQQ uXZ[RRhp^PsX PGT1 ttu~u `up1+t&PjSRh3蟒1҅tPЅu[u։1t J ЅuR P%XZ[Ðt&tz tRjPh381҅tPud Rу룐&SQQ u[X[RRh]PcX P7T1 ttu~u `up1+t&PjSRh3菑1҅tPЅu[u։1t J ЅuR P|$[X[Ðt&tz tRjPh3(1҅tPud Rу룐&UWVS(D$$P#@$"D$$D$ D$D$8.&G,L$D$AL$T$<!WӅtȅt9_%7t$ VdY1;t {t{t S?Yt&TVh` hd4RZYƋD$PV^.=t;uqD.L$l$ D9_t 1҅uW|$G|$0_Mt&RRPPPh hd4t$(SX@$+P ^QQL.SQ]PjOQjZl$ \$D[^_]PPSUUh hd4S9X@$P]"&UWVSjD$,P}Åu [^_]Í&D$ |(t|1509-G9}~t#TL$ 8uCPRQ_XuVh hd4\S;Ël$$T$ jt5me4z9~0l$$ƍSL$ 0uU  [^_]ÍB 4RRPQ 50Sl$$Ɖ0L$ tRR|$(WPPh hd4T$uDGPXZD$PSqWt;PPVR^WWWjS[^_ÍG~tG~tVQYD8렍&'VSVVt$h hd4t>uEP ZYh4PVtPPCVPVVVjS;[^ø~t~tV/Q[롐SSS\$u#Cu PPSjAP; t!JJSH щH\$XZ[SSݍSPPCtAC@ Cu5 uMCufPh hd4S%[à h`6?[PPhkSR辉 tt&Ph hd4PCtvRRhMP胉XSRY{ h64?돉VSP\$$&CuIPh hd4Sv 9tJstPh hd4 QNCtt&RRhMPXSRɉ뛍t&QQhMpVЈ [^Í&'VS D$t$Pj軯ÅptpkPPjj-KK؉SZ Z[^É'SPP\$Cu t<%CPPSjHQ蜾¡ 9tCJ J\$XZ[cvC%C܍vVSPt$CCt@ Kt%PPh@nCP荇XsVcVh hd4ST1҅uvuu`t 1-&PjKQh3蟃1҅tPЅu[u։1t J ЅuJD$X[^D$6X[^<rPPhk Qh hd4R RуD$X[^6RjPh31҅tPv. HD9+H $BH Ðt&J $ Dh hd4QR$PH $BH VSPD$t$u5 HD9~H $BHCSSjD$PqÉptRRpkjjss KY X[^ÐZ $Dh hd4SR$PH $BHR&' $t Hu ÍHQQjH Q=XH$ QPH$>&'SSS$t HJC$C@ C'C=Ph hd4ST1҅ut &ulu `u^1*t&PjCPh31҅tPЅu[u։1t J ЅuI P[Í& tRjPh31҅tPwJ Ѕt Rу P[à h`68PPhkKQÂPh hd4PCRRhMP舂XKQ^HQQjH Q#H$Y QNH$$ h67\' $t Hu Í QTNH$ Ít&'UWVS 1ҡTuzd1,Uj{Wh4}1҅tPЅu[u։…{J Ѕ]f@\hT1҅u5tvu u`t J1&RjSRh4g}1҅tPЅu[u։…J Ѕ@X\$\$ 11t&PCQjUquPPWVI Pj|$WG h hd4Ut[^_]Ë ` RjPh4|1҅tP_J Ѕ Rу1#D$( RуQjPh4*|1҅tPVS1ҡTu1&PjsVh4{1҅tPЅu[u։…J Ѕ@pT1҅u tu u`t z1)vPjSRh4/{1҅tPЅu[u։…$J Ѕ@@RjjPÅtPPD$PKQuD$D$ D$T$ 4t&jjVcPZD$T$ D$T$ | ˃wƍ S'$[^Ë `a TRjPh4(z1҅tP2J Ѕp Rуg1m1 RуRjPh4y1҅tP_SPPL$D$)‰u PPQS>ZY[Ðt&VSR,t$tE t1ۅt6T$D$)‰uPPVQ>t6 C tuX[^hyjjh t`B,뙃tՉt$ $tX[^t&UWVS t$ \$$PjCPVyDžu[u [^_]Ëht!Uу t9EPPVPPh hd4VbA@$PF h hd4OQ h hd4W,$=,tx t1ۅt?D$ t&)T$ )ՉuWWVQA=Y C tuQh! hd4Vm 1[^_]át@thyjjh t@,c1t t ME7uEPjsV URSSh hd4MQ@@$PyEPx,hu t1ۅt:D$ )T$ )ՉuPPVQ< C tuPh hd4_SH h hd4W V$thyjjh t?,SPh hd4EPERh hd4URP V$t='RD$PÐ&ot&' D$xCt^} ~ z&雯t&' dt Dt Í hyGcD$ ^&VSVT1ҋt$uu_tQ1"PjCPVt1҅tPЅu[uډ…tbJ ЅuHtUY[^Ë `t tRjPVt1҅tPtJ Ѕt Rуut&[[^+QVS \$,Sq…t8u{Stm[^Í&PPD$PRSt߀{StQPPT$Rh4%$=,L$ƋT$9|9r\$,땉諤[^à T$R踣ӞD$ L$ƃ9R9H\$ 9;t&'UWVS(@l$i&'UWVS| d ? $D$D$ tM&l$ |$ G|$ t=u|$ =l$\$$C\$D$ u襯 SSPhFì2XZh7h ȫ_]h hyG跫dW PPh(5h-蕫]XhUh3d$,^_h+5h05kY[h h95ZXZh h@5I_ p]QhI56-dt$@R5QQuV5Ph4 j{j D$dPUU4^_RPơT1҅u =tu-` 1&UjKQht4l1҅tPЅu[u։1t J Ѕt XXQQVht4#]ZpphuFh4 $[^huFh4|=lL-@$P2C RjPht4d1҅tPJ Ѕ Rу5\sSSVhn QjSU^1҅tPӅ-RStD$|)0|%D(3T1҅u5m1&WjKQhZ4B^1҅tPЅu[u։1t J ЅUjPh3]1҅tPqQQPhXRjPV]1҅tPJ hs3.$3RR RуI Pу h+oÅi P1& Lh_hd4Q&l8,$蒺Y^SPo+XLZ@>PR]+` xUjPhZ4\1҅tPQ Rу,1UUVh5қXXPPVh5贛XX h+fY-L[PUÉơL8.PPjS(ƅPh{K1 Rу31q5LLPPVPPhdhd4S$|=(D=PPUhD7[S\$S蒒;LtRRPSAb[À{AuQQPSa[Ð&UWVS1ҡTu 1,PjkUhZ1҅tPЅu[u։1t J Ѕ.@tSht]M 1;\$4}4j VL$8RPPWSU\ C;\$4|҉[^_]Ë `: -RjPh/Z1҅tP J ЅM Rу?|$4ȉ1׉1 ƒ|$4%9111u9N|9Fv Phhd4^SB[XT$8 GȉPQUF9ӋE |9r;|$4㐍t&j St$8RPjPQWU G;|$4|UZ Vhhd4CP賷XZL$8)VUOC9 1U|$0_j VWPPRSU CL$0u+ P虐r~F~ D$juhuÐS\$PSP[Ðt&WVS1t$t5v^ QbYZSPWPc6Džu؅tu[^_à WQ[^_Ð&VSPP\$jqhq7j ƃSPCFK N SVCFC w[$|7t&PPSRPPjwhq7CP@ @$迴P%F[ PKHF[[^Ív'UWVS 1|$ Pjqhq7j\ƉGF_^O N WVGFG w]$7PP_SPPjwhq7OQ@$P$F_ PSPF.?Wt6u [^_]à U%P [^_]Ív'WVSPhhq7jyËWPw GC1u!C G1҅u5GS1҅uCS[^_à PVPC G1҅t‹GS1҅tč&k‰؉S[^_WVS|$PhDhq7jײ_XPSPFG uF OGNu)F[^_à PPOF GNtQQPRRh:hq7P@$[P:#F[^_ÍUWVS,1l$@RhUhq7jD$8T$8M EB}zu r ]ZEMBE JD$$Pjqhq7jljVPNHF G ^_VWF wR$8PPNQPPjwhq7FP@$jPI"G^ P=SPGD$$|$$6\ WMt$(F E $`8]\$Phhq7j ݰ1ŋT$20rt6^ PZYKHWP6Džu؅t AET$ru|$(oD$(,[^_]ÉXml$ Qhhq7jOZŋt$,>^8FER#KHE|$ w 1t6^ RZYKHWP6Džu؅t 0 E T$,zWEBml$Ph*hq7j諯1ŋ\$30st6^ RwZYKHWPx6Džu؅t h|$E1ҋG $Sjqhq7j1ljNHFGV W ^_NOF A$8ml$Qhhq7jޮZŋ|$$wOHPV1P\$Es t6^ PZSYPWP6Džu؅t 0 E T$$Phhq7jPMËy x uXVRCE_HQl$8C]D$(uQhDhq7j^ZNjPkhGF !G VFWt$(G~D$(6uQhhq7j蘭Z^D$ F|$ GRj~ kL$h|$D$ APjUhq7j D1ŋ\$st4^ PZSYPWP6Džu؅t0u_ ET$ZSEL$D$ El$ 9|$st{D$ t$F D$(pD$(( PI땋]Whhq7j|;^Ɖ8CP,ZkFUFC L$(F qD$(uWhhq7j &[NQZ~CWC|$(_D$(|ml$Phhq7jګŋ|$wGE1t6^ PZSYPWP6Džu؅t 0^|$Ew 1t6^ RXZYKHWPY6Džu؅t |$E w1t6^ RZYKHWP6Džu؅t 0 EL$(yWED$(hD$(VuPhhq7j踪]ËFPlCl$(]D$(}Phhq7j}wopw Éh1C G1҅GS1҅S0uQhhq7jZNQCQQFPPPjwhq7VRg@$PG^ RKHG$<$6k3+ WF‰U T$‰So WE# PE PE l$UEt PE PE& PE WnEQQPRRh:hq7PI@$ȨP Pn P]G> PnVP'WVS|$t$ _P7SPFG u$F OGNu0F[^_Í& POF GNtSSPQQh:hq7PS@$ҧPF[^_Ð dtLt8uIn  à h ~t@t@tRjjPpuɡ t à P3t Ð&DvjR_D$$ (PL$QRX(ZPj O Hxu*(Rj jh;9X(P\t&Rt (PhG9Q뵸Y9␍&SPPdLugn  dP(Sh`9PjL$RQD$(PS@XZ(Rj  XZ[Ív8t PÅu뀍& h c}t,@t&@tSjjPԸÅE& " d0t&+ LP=ue9PS(h~9Sp  jpZR PD$Ph!Ð& dttLuNn R(Ph`9R L$RQD$(PRX (ZQj $]8t Pu뛍 h |t#@t@tQjjPtc VC&SPPdLuWn  dP(Sh`9P D$RP\$(SRX (ZQj 0[Ív8t PÅu됍& h #{t,@t&@tSjjP蔶ÅU& 2 d@t&/ LP=ue9PS(h~9S0  dtkLuKn  (RPhl9Q T$$ (RD$PQ XZ(Rj Í8t Pu랃 h  zt%@t@tQjjP}l ]J&'SPPp dttLuTn R(Ph`9R$ L$RQD$ (PQ $ (Ph9R [À8t Pu땃 h ,yt%@t@tQjjP蝴c TA&'W dVS|$Ln t=ơh du 8QQW=L=ue9PVShz9(S |$VWt$(VP X (ZQj  [^_À8a PÅPFt&(PSh`9R녃 h wt%@t@tRjjPLÅ PPVS 5L=Wue9PSh~9 jv'T$D$ D$D$!ʉD$D$9 (uL$ dt&D$!Ћ(uÍt&ru<_u CST$KL$[ t$x-dPPUWW=dhh9WA@$P\$,T$+x lpL$P5d-x h=D$Tl$dt$\T$`|$h\$lL$pxlD$d-lJ|$DT$`t$PG\$@L$Lƒ=5ht$\ ЉlL$ \$XL$T5x(l$ =p-d |$<] Vmt @=x|$<] S|$<]`du/3t& YQhh9 QN@J@U< qtPhh9QR@<듃|$<][ Pnt 811ң5ll5p\$4D$(t$,w>v 91l$4L$(EL$8D$(D$,l$4!>%ƅMRhh9P xShh9P:D$(T$,t$\$llpSv#@_V?OYɃ|$8$7Y/nVhh9iU5@<VVjRD$L|]|$T$<׍ol$_D$<]\$P<hh9UjjV:|$'>t {=t 묉&À|$'&t |À|$'|%tu jq<*|$'*Át H-€+ Шt8\$'t3-+ Ȩt8D$'t'|$'=tlt$Nt$luÍzt$1ۄtt €  ШFtUtU   Ȩu tD$0T$4<[^_]WÉփ>Ӄ% 11ȉN:Y 11ډa 11ۈȉSN:H1ҋ-lQt&'UWVS,Ɖ׋l+ƒ- Шt43+-u)׋l+ƒ- Шủt$|$K݃Ƌl+ƒ- Шt.`+tT-u)Ƌl+ƒ- Шu҃ t4T$D$ tD$T$u끉D$T$ tщ1ˋ|$t$|$ t$$kƒ< Шu >\$Ɖ׋l+- Ȩt4+-u)׋l+- Ȩủt$|$ s݃=Ƌl+ƒ- Шt3~+td-u)Ƌl+ƒ- ШuҐt& tBT$ D$ tD$T$ pt&&nD$T$  tÉ1뽃|$t<|$tX|$$_]jh0$Y[jh "$XZjh$_]jh$Y[VhP iXZVh` \$\$ ~M\$Pjh%= VUUh h8<V@$rNPQP萔Ku h=m{fZ jtIC<tIƒtBꀃ   j6  <u1붃 j/ ju jáLv2<1VSP蠶BË0t3X[^1҃3X[^Ð&VSP1t\ uS1@59}JC9}9 tx u@tPPjSB͍&Z[^áHu;5t1҃Y[^(&UWVS $ t  tuh [^_]Í&1@59 vC9tx u@tQQjSuʃ $SBXZjSx^t$ V- VS1j9} uC9|PjVjƷ [^_]SjUP׃u֡Cʍ&H;51҃UWVS $ t  tuh [^_]Í&1@59 vC9tx u@tQQjSʃ $SXZjS^t$ V͸ VS1j菶9} uC9|WjVjf [^_]SjUP׃u֡Cʍ&H;51҃wUWVS $ t  tuh [^_]Í&1@59 vC9tx u@tQQjSʃ $S肷XZjS踴^t$ Vm VS1j/9} uC9|WjVj [^_]SjUP׃u֡Cʍ&H;51҃VSR hu dty5 uo1@59}D C9}-tx u@tPPjSYΡHu;5u&^[^Ëka1҃Y[^,UWVS 1(v$  $$u [^_]É $S訵XZjS޲Y^jSԲXZjSʲ^XjSYt$ Vu VSj9XHvZUSx!-@vQjVj [^_]Ãt&UWVS$SY^jSGXZjS=XL$ Q T$RSj貲5tnUhh8<S}G9t:k;tPhh8<CPYGUhh8<SCG9u pt$$t~ Pf ƅ(v=u5PPSVWhh8<j{E$ p@@ hl$$t5,vQj50v|$WjF [^_]Ës Dv b j. jhj-(vu;DvPPjj"]Xjj"Y_jj"XZPSs$$ui;Dv.RRjPu Dv WWjj9"Y[jj."XZjj#"$$,v [^_]Ë9t Ӊ‹9u } h*=tt%;DvtSSjP~Z=YjWn=t^Phh8<SD9t"S+tPhh8<KQdD#MUUjj&!Y_jj!XZjm=UWSh/=蟠r&UWVS($SXZjSGX$P $RSj趮 5 us1@59}?C9}.=tx u@tUUjS ͡Hu;5t1҃ u:Whh8<j A1҃ B9|-h΅t\uNu`=d91$0t MM+Wj$VjW8v,[^_]19wgF9|`bv9mN-h h8<SUQA 9Σ B9|1&Qhh8<j @Ńы9‹9ut Evыu=(v]EtE}1ۉ1ɋB z% 9u1u  E h+^RRPWWhnh8<P@$?Pt $4EUEEL$,} EM@9uX9T$1\$ HꀋD$ D$9KAG<tƒu<u1˅](v҉]qEfPPjmUQ P?#- PvΉ)9})։ȅ 1ۍ$W膬ZYjW輩X$Un UW1j09|C9 tx uP9t щ‹9u,v9BtGPPjS9멃 hJ=,_Shth8<j o=[t$ RRWVw h h8<QP==|$PjUj ȉtߋPh4h8<V<1ҋ 1ۉ9}=tBC9|9 B9|=Phh8<W= 5jUjy؃ OK £Pv& Hvt RRhP腬x Hu 1҉Ѓ ÉPL$HvQhTRu؋$ftfD$ftQQ%PQYXfT$ RD$ %P뎃 (Q1RSPPDv@h (Q$Ъ HvjjPFbDvHv  HvQy@vDv9PPjjYXjj袪XZSj뫃 ((v$ vUWVS8$$LSjZYjS蠣XL$,QU T$$RSj(v5ht-(vt9x69u1ɋ59})tP9z]9PuA9|݃M s9^ ut6J u'@ht(vuN X =H1ۋPBtË9Pu<ƒꀉT$ 5H 1ۋ衑Lv=)tRRPjLv),[^_]1ɋ-9}(tP9z9PuA9|ރ.虞 Y=p  @F F) C +PPh`jLvȉF<VƒKꀉT$ F<t5Ct=DvPPjWd ` Sr<tut <9Wuމt Hv"t!RRhP~x H(vtW^_Ph<ىȍt&|$KKHHRRjrV蹕$4Sj$WjЗ1[^_]Ë (Qjjh<蛛PP;WVD PU 5(Ph}=VYtdhPPhh9LƅG<=RRjPRP (P蒒\ 5(V{P\$ HvShTR謙T$fxfD$ fjVV%PV Y[fL$Q|$WJ.u-\SVUh\>܅ j$Wj0Z=\UUWh=̍'UWVS$$,VXZjVP_$ W WVjƕx  Q9t щ‹9uZQjWj茕$,4$誗XZjV<$蘗 WVj\t5tx t6QjWj6[^_]ÍUSSRh>[hhQjWj[^_]ÉUWVS($$<UXZjU0XT$R D$PUj襔t9x"9u1ɋ59}+tPv9z9PuA9|ۃ1ۃt  YVjt$Vj+ W,$D$;XZjUq^D$P& T$RUj1ɋ59}$tP9zt4,9UuA9|Qj\$Sj褓D$,[^_]ÉAt֋=tɃx uËHH븉*QQWh>밐&UWVS $$ WWXZjW荒,$E UWj 1ҋ 9}t p u@tB9|9 P9tэ&‹9urPjUj袒蜏 V@A; 8* $RzXZj$S詑XL$ Q^ D$P$Vj1ҋ9} t@ B9|Pjt$VjK=VjUjÑ^tx= un1@59}@C9}/-Dtx u@tQQjS̡Hu;5t 1҃ [^_]ÐHvT$RhTPu$ft fD$fu QQ%PQYXfD$ %PL$ Q訩 Ðh+jÐ&PjÍ huT(vu ÍPPh0-jBY Xh0-j/XZh0-j PPh3 jYXjjXZjjYXjjXZh+j Í& H PPQjXZjP薊$^É QjXZPjpXZRj`YXh-jR DvXZjQXZD$PP($Ít&WVS $$S;XZjSqXt$ V& VSjtN14v8v9}0ttH uPPjSC9|ЅtSjVj脎[^_Ë=Ph h8<Wk#SjVjK[^_É'UWVS$$,SJZYjS耍Xt$ V5 VSjt919}3׍ttx ut PPA9|QjVj訍[^_]Ðt&WVS $S貏_XjS^|$ 1W蛏 WSj_19}" tx %B9|SjWj#[^_  Ðt&T$(v9‰(vtt Í&'WV5Stqt&Phh8<S!9t:C;tPhh8<SRy!Phh8<Sc!9u j(v[^_Í'SSS dt@1ۋ9}&tx t5C9|D$4QV2ƋU 2RSWQ趋U ډU2hh>W [^_]Évj W跉WPk'UWVS(ՉD$D$ 4Vr؉D$ t]t$4\[t%L$09uyt'PPRT$[^_];l$ D$T$$D$ T$L$).QPRjHw6$L$T$L$늊L.`€\ Шu $_EY]WUWVSD$0T$4D$T$L$1"D$L$t7T$:t.D$ zt(D$ zt RD$ D$ 1\$!;\$tT$ ֋C 8W輆Ƌuۍ^WhOh>S%l$(ljD$ 4T$Gu Pq PQWmt>t$ ;l$t|$ ~SL$Q\$SWԇD$ǃ뚐D$[^_]Ðx/l$4PhBh>7V@$kD$@,[^_]Ct&'hM<D$P^Ív' hT$L$D$RD$P/Ít&'UWVS$D$D$jP跀t^ 1VE1҉9sD<<%)w2S9}%t&C17G9|9r>[^_]É9D$T$D$T$ L$)؍QPRj-Hw*T$L$ T$L$댍B7G9p똍lgUWVS,|$@l$Dtu?tpD$t } L$H… Шu}uT t8 €  Шu u/Et(}t1ȀtC u1,[^_]8t߄tD$D$$1?v}'\$$t7v|tu9u}tPPRUVt$4D$ 7tC À  بI @<7tNΉL$$1Ȁt9\$$ލ^L;t( €  Шu uEt }u8tNJ 7D$ Łt"Et}?1ۈˀ6<7e|$L$) Q  }:D$D$ >SՁD$<'t"w=F7<'uPVD$,PW/7^\$$\$T$D$\$L$)7$QRSj蹁@ $T$FL$T$xCC\$\$$  € %  h=RI ËHHhh>Pr hr h>j.YZ@T$RSLD$$zD$ ~) h=H ËPPh넋D$,[^_]Å֊7} } }D$8 7 € % NΉL$$ UWVS,l$@t$DtqEtj8te1t > … Шu-uN% À  بu u/1҈ʀt"GuՋL$H}tt$H>,1[^_]ÄtD$$<'l\$$t3+t9u~tPPRVcu CuPSt$,VWp\$$\$HD$t$$T$H 7 D$ 7tY À  ب&D$<7t5V։T$$* €  Шu u1Ȁt\$$ލ^L;uˊ 7D$…Át01҈ʀt# À %t t NL$$΍7D$U,[^_]CC~ ;~ 1~' ~D$D$ 1W}Ɗ<'%tjtwC݀ D$T$D$ T$L$)؍QPRj}HwAD$L$ CD$L$몋t$$[PSL$,QW蚯st$$sÊLVSQ\$t$t;uK9w-AZ[^Éـ{tK{t S|Lϊ< D$<  Шu3|$ t,t|$uA< D$<  Шu|$ uI1ҊT$uÍ&'SSS $1t,RRP CPkD$sG  uԋRRPKR:D$BGutu[Z[à P袬[Z[Ít&' $1tt&@ $u &@uÐ&SPPT$D$~wtgщƒ!@ttJ!@ut9PPKPPPhah>S Qz@$aP@[Z[Ð1[Z[| w 1tPPRPPh[h>Rz VSS $1t,4 RRPVBC$E  uԋRRPSPB$EutuW\$ƅt.hD$T$QQD$ PV4$π؃[^RRhM<Vz4$谀؃[^à P迪뛍v'UWVSH1ۋD$\D$<D$@Py T$T@T$h;h>P D$$ljD$,L$Pt=t&1Ѓ'9";|w^t$P GCl$PTuD$<[^_]Ã\uCl$Pt$T+ t$t1Ɉz@u\G{vl$4T$l$ l$P݋L$0t$0)L$VRUjyƒ@iD$T$ D$0T$4PVUWzHl$T l$tG2CT$P\$,D$ D$$ 4V#x,<'%t%{wzCt$P<'%uPSD$4PL$\QzƋl$PT\$,t*UUPW} WwhXh>VH \$,iT$ $T$Pt$$L$ )؉t$QPRjwpw=$L$D$ L$$@t$)T$Ѕu &'UWVS(1ۉT$D$D$ PvD$D$$€` Ш<>'€\ Шu`"t[{ywcC u|$t D$ RRVPPhh>V6v@$ P{Ã[^_]D$yvD$L$)؍|$l$QPRjTvHwQ|$l$ft&`PP\$SVT$@1ۃƅtUUhM<PB4$x|ivSSl$UVC'VSPD$t8u1Z[^VV1\$SP;@ÅtQQhM<P${Z[^ÉVSPD$t8u1Z[^VV1\$SP˓ÅtQQhM<Pu${Z[^ÉVSQQ\$h h>St@$ Ɖمtt&t\tt@AuZ[^ÉAt&'UWVS(\$PƉD$t*<< ȨtFww CFuD$ [^_]ËL$T$)ً|$l$RQSj%tƒ@w!|$l$tŠCFJuwЅu␍t&UWVS1D$D$ SLs @T$ hW h>PƉD$WWjSn t4uK€ ШtCtuw CFuD$ [^_]Ðt&D$T$)؋|$l$RPSjsHw'|$l$v‰ CFJuduVVS\$Sw닐&UWVSt$0>u0Uh h>jD$@D$ [^_]Ít&D$D$ Vq DT$ h h>PiÉD$;t$sCtwFC;t$rD$ [^_]ÐD$T$)|$l$RPVjqHw$|$l$tF CJu녅u፶'UWVS 1ҡdl$ t Ptu D$ D$ D$$u tZ:uU6_ 3V h h>VG?PPuPPL$QUe[^_]É1&_ 3VB h8 h>V=?uPPL$QU[^_] UWVS(\$RƉD$D$<UUjS^k<;|$|$to CFt_uC;tUrvL$T$)ً|$l$RQSjpƒ@w1|$l$tŠCFJuuD$ [^_]ÉЅuְҀ{KL$ [^_]VVS\$St&SQQ\$&CuXZ[ÍUWVS ƅT$|$ t8uF1,tcOWWVSSh h>Vn@$1Pt[^_]ø~t~t V|n,u9wv L$=P RV|$WlHD$C9vbtCS9I=P SWl$UllHO9s9=P RW\$S2lHuoG9v9 L$=P RVD$PkHucD$K9sD$RRSPPh h>SJmPPVPPh h>V+m@$PrrL$ VVSQQh h>Sl@PPVPPh h>Vl뫍&'UWVS,Ɖ1|$@t@>… Шu;u5PPVPPh h>Vl@$Pq,[^_]ÍvsoPSjL$0QD@PVjl$,U,D$@\$$l$ \$CO UiD$Sh( h>Njl$,U h) h>L$0Q~ VkÍPh, h>R-ōD$D$D$PSt$VUl Dh0 h>W ډW[1ۃ=ҋ|D PRUD$PiH|C;\$ v\$ 3=|DQɃ QUT$RiHur|Kytr|$ \=P QST$R6iHulOyyPh# h>D$0P ] ||WQ1=P PSL$QhHuG;|$ v \DUg\vUWVS ƉՅ\$ t8u1<t>tS1 [^_]ø~tذ~tЃ Vi<uĉtNJM]!;w<$x?9w=R VSUg8C9vz8%h9^;Q= PVUgK9s&9tfM]!;w$h@8%t@9r:T$=P PVUft~L$ K9sF:뭀;(t8tFv;(t럄:;(8a;(L$$\$(;8D$l$$|$(u㐍&UWVS 1ƅT$t_ FT$,RT$É$0DžtPh h>SCPPUW36Ņut |$$*tfD$(t>6_ 3V h h>Vw?VVuPPhM<U,$m[^_]D$(tؠhD$ D$ QQL$QU,$m[^_]à P—J&SPPt%1ې;}<uCuY[[à Sb Iʉ ƍvUWVSXljD$LD$PD$4D$04Vf؉D$,t/D$(ƒ\ ШtLD$(C uыt$$%]1L[^_]Ðt&<$}`W<$'ƒ" Шs't$<D$0D$47'% 7D$(h&T$@t$,L$DT$D$@)މL$PVRjKeHw^D$T$CD$@T$D1D$d]L[^_]À|{t$$Ft$$ L$$C  VT$< iKgw'C €'%uހ 8T$0D$,t$4T$L$0)؍t$QPRjXdpD$L$D$0L$4둀|(ID$dST$h>T$LPSMQW*]fT$@D$,t$DT$L$@)؉t$ QPRjcpD$T$ ^KL$h>T$RUWVS<օD$$D$0D$4ts8tn 1R`ZD$,D$0P`D$tFl$T$$ 8 >'z"cwG>؅u1<[^_]ÉD$ \$0l$4L$0>)\$l$ QPRj`X@D$T$ GD$0T$4럐t&\uG>t&cvD$ \$0l$4L$0>)\$l$QPRjZ`XD$T$뗍&Ql$ >URPx`!OD$(D$,ˊ<'%u] ߃>D$ L$()؍|$(l$,QPRj_Hw3|$(l$,C €'%t&bv몍&t΅i׊>c oUT$04NJ>D&UWVShD$\D$`T$HR^؉D$8D$pt D$p8D$(L$t0T$t:#D$$ztD$$zt$x L$x9D$,ytD$,yD$4D$0ފ\5t3D$4\ ȨD$4FD$0u…|$0ÅYD$<0\1[^_]D$(xD$(x PQ]L$tD$(t$xD$$D$,t&D$4`AT$PD$8\$TT$L$PT5)\$QPRjJ]XD$T$D$PT$TT$(T$p:T$$t D$t:D$,L$x:`'Ã" بN'L$LFD$@D$DD ˄<'%2L LQL$,D5QRP\S&L$(D$|\$LPT$|R\$|St$|VT$\t$\FS\$0D5SQP]\"L$0L$,t1`VT$LVV苴$Vh=T$\\^T$PD$8\$TT$L$PT5)\$ QPRj[XA; QT$HD"]w&CL€'%u݀ރt$@T$8L$Dt$D$@)ڍtL$PRVjZHwmD$T$D$@T$D땃 QdZD$,P ROZD$$D$S- ËD$PP|$DUS]T$\YD$T$ PU$Uh ESGT$9' D$T$jh-jh>BÍ&' D$T$jh-h>L$ QÍt&' D$T$jhh>h>Ít&' D$T$jh-h>h>Ít&'UWVS(1ۉD$D$D$ RCX$t/;D$R't-"#'[w,Cuу1[^_]Ðt&\uCuۋ$L$)؋|$l$QPRj8X@C|$l$뛍t&KD$D$ ˊ<'%u^ ^t&$L$)؍|$l$ QPRjWHw,|$l$ C €'%t*Zv뫅tՅӊ {WT$?Ê[^_]Ðt&UWVSÉD$ jP%XZSPPhh>SV@$P[ǀ<0=]Phh>jpPPj[W:L$RRVWLÅl Wt kktUhh>VVhh>W1҃tCu @uv [^_]ÍUUWhHECtShh>V;Qhh>W' 1[^_]jT$RVWL3PPj[W9t&\$trPPVW_t&00Xtx(t|t ;RRSPPhh>ST@$aP@ZƃhIPPVW tPh h>VNPh PPj)S69oD$D$jh-jh>T$uPPj~S8tڸ~uQVVSQQhh>ST@$PmY1҉$ hh>UUUjS1 D$1t&D$UWVSHD$<D$@l$\UwS_D$(t$dVhS1D$TD$ D$$9\$$tD$$;t$T<1[^_]Ê\5\tST$X:'€" Ш'uCD$(D$,F;D$T\5\uD$$F;t$TmD$ <[^_]à VT$,UvˋT$0D$L$4T$\$0T5)L$SPRjRHwED$T$FD$0T$4넍D5QWRPR$L$ );t$T\$ VI;t$TCU0T$0D$\$4T$L$0T5)\$ QPRj5RXwD$T$ `vUWVS(1D$D$ t$PL$8ŋt& teT$ txT$P€"%uD$PtT$t&.\FD$ RC8.F uD5t$(<[^_]À\T$t(`T$%C!‰T$ .FG&`tB$"vT$PtL$CL$1z@C9.`CFD$D$0T$4D$T$D$$L$0)QPRjNHw?T$L$T$0L$4‰C9.FJu}CD$ ouҰΊT({ ȨCD$ D$,|(PPjjT$<2.$TT.tR1Ҋ BD5FuT$,\5D$,À<u"D$ Phh>QFXءtLD$ jh-h>h>T$<^UWVSX\$p|$lD$LD$P4VL,D$,D$0tt$8D$0t%D$0؃L[^_]Ð\T$,t0`L$,%!L$,;OC u몃`'ƒ" Ш'4 KQ7NvD$@T$DD$ T$$L$@)QPRjLHnhD$0YD$DT$@D$T$L$@)QPRjKHwD$T$D$@T$DD$,$!ND$DT$@D$ T$L$@)QPRjSK@:D$T$ 뇋D$ T$$zKD$8D$<ˊ<'%uf aT$8L$h>T$D&'UWVS|$0?l$8T$8t$8D$%D$ tdShh>\$D1SI@1ۉ$D$L$8t) €  ШuD$ FCT$8 uڋL$1D$17t6RRSUT-t] 7 €  Шu uFF7u1[^_]ËD$@t T$@L$Dt܋\$DЋ- 7D$D$tSUVW@D$(9ƋD$Åt 7ST$RVWzXZL$ QS$RD$ hh>Sk\$$C\$$D$9t$<9D$<tD$D$T$DÃ|$t F;D$<?D$D|$t 9t$<D$<t3T$ t$RRSU+F7ul$D|$t,D$<;D$4|"L À  بl$l$D$@t \$@L$ t$Dt |$DT$l$t T$uTD$[^_]F7kRRQU+t: 7 À  بù tDŽ1 R'w 7RRST$R*FL$ D$t{EvSSQU*\$  €  Шu T$BT$\$uRRSD$P.*}L$AL$T$udSST$ Qh=G$t$$\$t$ Ft$$\$\$PPT$ Rh=$~|$$GD$|$$''UWVS1$$< <t ==hD$ l$4UCH0vT$ `u Dv fPPjjȑD$4de|$$u]}QQj|$8WD hpE5$Gz1ļ[^_]t 111L$8Q?T$($T$D$D$\$xzM+L$ AۉL$ tߍG9|)9}hh>VD$P$D$D$ƒ ШD$G\$yt$t\$;|$tPhh>l$UW1 ËD$4P>t$44$5TvўL$4T$0 Xv0v==htt `tU؁ļ[^_]ÐL$G6ShD$8Pl$$U=Ņ$T$0T$ 辘RRjPώD$u)T$|: uwD$|0)υ؋\$;D$=,WWjV=$E hE3tUhgh>V \$4S=^t$8V=1~oPjU|$WwD$c hE뗃 -,U4=9D$, ,Q=9D$(3-`=@h-`u $ VVPË$PE h h>SXZj\h?D$,u,1҃|$tH|$tAL$u 萏 POC }j҃ $P<9D$, (R;T$<9 R< 5$V;9D$( (S;T$89 R;CSl$ Uh>$W5N5UUjh2>ƒUWVS Ê1@€*l$$ Шt { EStyPjt$VSƅ@L$<@<*% t y]PjjST$8u [^_]Ðt& S'tPu Å%tLD$ tU Vt$8뢀*O瀁ǁ [^_]Ðt&T$(2fvL$(OEQjjhUH\$(N u'WVS1\$ |$D$D$ @vF&@WPSj|=…u݃[^_ÉUWVSLD$l\$d|$`D$,t T$d:L$,It$ht L$h9_1 W< Ílh7h>UD$DL|$,IVVWT$@RAXZ|$pWD$@PAD$4L[^_]PhGh>j@@D$DL$hD$h8D$ xD$0ul$d?Å ب\T$d:O>SD$hPjL$LQr@xRWl$DU\$DSwrD$@fT$8l$<\$@T$(l$$\$ |$,d|$,Q1Ph4 h>L$LQ h5 h>D$DP h6 h>l$HU؅\$HT$ )L$09|#@9}hOh>VD$@PD$D\$ T$l|$D T$,u9|$HGD$DDžOL$ W?:l$0D(9r2@\$0C9shkh>Vt$@VD$DQQWD$@|$<1\$(=P PST$,Rr8t1E;l$x=P PST$,RA8uϋ\$$L$T$HD$D7D$ xo PW9D$ Zyfy Q%9svST$HR\$PSl$8UT$tP\$SL$pQ|$@l$<WD$LP L$HQT$PRL$,1D$(D$ ËA߃;w$HB9%td\$9|\L$(T$L$(D$(=ɉT$ PQT$ RD$,P5-D$(T$K9}E;l$ZRRWPPD$pP\$@S<]XWD$@;R;(U9uL;(C:);VO;(S9rF;(=0D$4T$0D$4L[^_]ËD$0@D$04|$t3 WV6L$0D9)@uۋD$0@l$09sD$(L$ L$$T$HD$(,l$$UT$HDe' UD$dtPPhjh9 ʅt1t%Bƀtuth Í&1h Ðt&Ív'VSPt$1\$t.N%u=PQSQ蔰Z[^Í'UWVSD$0t8u 1[^_]ÉD$SSPQQh{ h>P4@$:P: D$jjjT$DD$ 0=D$ =D$T$ v|$ 1_15t.K%u=PQV Q袯RRPUFe?Ņu \$S:n MQ h h>VPvn6]uȃ[^_]Rh h>PL&|$ D$% @TPTt&WVSÃHuQ5$1tt&@ $u  &@ uƉ؉[^_Í&@€* Ш1zt {> sVPL$QT$RVÅ~@t11҅s1t{L$<@<* Шt y]YPPL$Qt$VC1 uKL$T$:ztzt R1‰D$ Éփ؉[^_À{ $1t@ <$u  &@ u{!w*$8C,v1WWRPDž?1t1t 1W1Å PhWWT$RV$T$$щƒ!@t!@uPPs>WVVhah>KSu0@$P5i3?1,Qhh>W؉[^_Ë=x~L$QT$ YAV%D$É1aPP[O`PPC5$1t@ $u @ uQQ11N11#1tt?t11 W/1 V tPu VVSQQhh>S.1@$QP04$XZjVÅtPPhM<SCPhh>V=t S]5}1t)?t$1{HPh11| T 1QQPRRh[h>P.QRPWD$1҃ G WÉt?t1c1R W-1= |$W" W!NRjjPRW0v8t+?t&1. W111t?t11 W,뵃 W~.t&UWVS ljօtuCUUWh> hCh>W;tWhDh>V# [^_]<~PPj~RSSVQQh5h>V.,@$P1XZjSŅtPh8h>SPPhM<U莤à tdPWh!tPh;h>Sq U2+QUUj PPjV]=땍v'UWVSNj@$$$DŽ$DŽ$DŽ$DŽ$DŽ$jh ?$`$$Ń9=q9 4ʅtAʃ:$/ ]#)DŽ$!TKЀ M1zDŽ$#o@ $t#$|}W $ $*0< $#$P$EQ$S$R$ND$0,$tME<@ <*u Ut*PPj[U(tP@Ot *\$ $DŽ$1ۅ҈t L$ 9ƒ}%DŽ$$$$҉t$ 1ۅP$-\R$P苼$WT$0‹$$$$D$DŽ$DŽ$ 1$VG(1$D$|t:&( )…% NC$ uϋ$ހ>:1 h $ҰZYÍ$WP $$hh>SO$ D$D$|$|$|$L$\$!A]$$8;T$=| ;D$1)|$9Ft$ PPD$PSSh?h>T$(R&@$SP2,$ 路 hAh>SRXZ\$C:WV $$hDh>V $ $$ |$t2$$;T$|;D$vD$T$$$|$QE|$|$1ۍRhh>U$tPhh>$WYt$ tPhh>t$,V9[^_]Ë$ }#€? Ш@*v $P苔$GZ$c -8%t #B$]$|$ 9… Шu \$ ;6Ph9 U/]$}…%t#-ƒ? Ш#t&$}…%xpQQVh?t$D$ <}O];v1zDŽ$* A$<-$UXZjh ?$踙 hGh>P;#$踷$Ŋ 7$<!PPESPr( hQh>S觸$U$|7}1ۈzB JЍ]  S?Phh>U*$$/xPPVSt&[^_]É&1ҊMʋDPu,_t'A< v #€? Шu@t *kDŽ$[ S$ S SD$ PP;Ph?u$tSh$h>$Q\$ tPh%h>D$,PPh&h>U۶PPj$Q$趺$$<}O@$<!#€? Ш1@(*t&<}DŽ$}($$…%t $$$DŽ$|}|] ]S&PPSQQhh>S@$MP,% j$QPtRhh>PG$<@<* Шt y]Phh>S8]$#]$}yDŽ$i$}…Áj$$?t=+&$ÅV+f$tRhch>$V%Phh>UD$0<}hph>jULňX@$49A$#hFt&:…%aOT*@ Ȩs"1ҊMʋDPu _q]PPSUUhh>S@$P"D$4 Pcl$DD(U$ jjPUŋ$|7* d1҅P$Ƅ$$u:6_ 3Vl h h>VgG?PPuSS$PU2$$…t $$t $Phh>$V߱ hh>U̱ hh>D$0P赱$$؉}}Q$$…%W$X$FVV$P苜$ST$0, hh>U$tPhh>$U|$ Ph/$$D$pT$tD$|$$)QPRjPHD$pT$t S D$ QQ|$Wh1? $:w?GYDEPPESE \$ tPhih>|$,Wޯ$=D$ % ?x+tt$$Åt $$t $$P苼$W$QV$2D$0Ph}$Y:$$T$hD$l$D$|$)QPRjzHD$hT$l$$}Ac=xU U $tPh-h>$RHL$ tSh.h>\$,S(Rh/h>U5d+e$$…Át $$t $T$ tPhUh>\$,S$D$ C$P苌$Q$Wj+$0D$0 h\$x]ÁZL$ :*_ 3VТ h8 h>Vˬ?ukS$$$T$dDŽ$DŽ$D$`D$\~tD$\~t VD$\_yD$`@D$`L$`tKu؋T$d\$`)z3wC<mOߋ$$D$HD$\T$L$)QPRjP@IT$HL$L$$뙋L$`$$D$PD$\T$T)ȍ$QPRj@T$PL$T$$l$1t@ $u@u@‰D$T$x]$PPUhE hnh>U航 hoh>$U S$$9t{D$D$y Q D$D$$$‰$T$1ҋ\$T$؋YD$A\$D$D$D$T$$$$tЋ$8tD$D$xUD$D$x; P*$P$WV$RT$0) h=h>ËD$,P h>h>$VШ\$0 hƄ$$WW$WP蒋t$L$$$$A QD$T$$$T$DD$@9 $1t,< RRPWC$  uԋRRPKP$utt PCD$4D$@|$49}A?9%uD$@|$8|$<;L$D}A|$8?;L$Dut$8}*%$tJD$<V L$(AppD$(uVVhM<L$HQ̉9|$8tD$88 |$@W\$@\$@$t$@1ۅ \$LSz hh>T$LRq\$PS|$hWVACL$ƅu$$1ۅ VÅwWhh>VP$P$Q$S$R$V$W$HQX Ɖ$1ۅ P耛 h냊D$\0 VQHP$P$S$V`ZD$` $D$<VL$0AXXD$0uhƄ$$SS$QWW$WS$ƀ}@Phh>Sj$$ SRhh>PB$?t$VT$,B\$,HۉHu$$…t$E$$ &UWVSj$@|$Tt t$Tt$L$1؃<[^_]PVUl$U?ƅt8uWhh>P蒢닃 Px{PoHdRjjXS+Åa8t D$P SPhh>V5,v|$Tt T$T-x1ۅ|$<7Ft$P\$\SUT$\RT$$D$==8xtuPhIh>SJ1ۃnrt$jhh>h>T$ D$蛬Z\$\$ h QZY\|$WS( hrh>VՉѠ hsh>S辠T$ d5@=$1t,RRP CP$%   uԋVVPK1V$ut )$tD$PtEl$Xt |$Xd1҅8P-#D$D$D$Pu: <$4_ 3V~ h h>VyG?PPuSSD$"P|$ WCZËL$ Qvt$c1-xȅ‹<`Á1ۅ0?t D$Po WޔËt$ 5$1t, VVPQC$  < uԋUUPkURL$Tut L$PŃ…%1ۅuQD$P hD$L$SSt$&VUlj$ h h>W U'-(PPRP胬WW5$1t@ $u @ uQQ묍JL$jh-h>h>T$ D$l$Ɖl$t 8(D$dPT$BRD$ Ql$U:ÅQhh>Vx1ۅ4 Vf hh>VӜxt-d <$(w .Uu h8 h>Up?u PI/t&UUjWW|$XWVD$ $L$!D$" D$,Pd1'PPUW P+7 P7Ud1҅PD$D$D$Pu:6_ 3VY h h>VT_?SSuPPt$$VU"~|$X҉% L$X U T*_ 3Vΐ h8 h>Vɚ?u|Wh9tD$Pu Q苐q Q}c WoQQhM<C@UUPWWh^h>P@$P P~HD$0 <)u2 h ` hlh>WShch>W xv'UWVSDŽ$fD$$D$PT$LDŽ$h2h>DŽ$pjpEDŽ$D$TD$\D$tD$|D$xD$LD$P Pm$D$t $D$`T$`L$@1؃'0 "$i D$Hu $1؀|$@<trt$`$$H9|69}$hh>PL$PQ蠗D$T$t$D0$C$D$`@D$`T$`1L$@؃'D$HoZl$@\$`\$|D$PD$T 4+V ,<'t/t&hC|$@<'uUSl$hUt$LVU4ƉNjL$@\$`|$|D$<>Qhh>V 1Ã|$<%  W h^h>Wۖv>t<Bt$@D$`|2(D$H-@zN?|$|P$D$PڡT$|1ljT$`t=>Á8t <O1ƅtPh~h>W D$`|$@<t @D$`&1\$D$>t"f~tf~t VNj$U)9::…hh>$ST$PRҔËURWVPVM Mhh>V?\$D5\x`bB$D$`T$|t $PPjh=T$pD$Pul$LEPt$dFV$WL$LQ1ƅPhh>S螔T$`T$`,D$ L$ fL$ $$H9|9v9}$hh>Pt$PV舓D$T$t$DT$ 0$L$ |$Dj݉$\:$@$ \$|S( )T$Vj@j4V裹 D$hh>j [/dev@/fd/@j $QD$RPۡZYPFP-9D$ T$@L$P)؋t$P|$TQPRjƒ@wt$P|$T^D$`HD$`cF@$FD$`\$@L$$)$$RQSjLÍ@$$sPhh>V,1ɉƃ|$`l$@WT$`/A9r@RRPV h h>S D$H~BD$`D$| jT$pD$P^Ã|$|nD$<+; S hh>S藑D$t j\$lSj= =} Vq~ P( h h>V Q~6uʋt$dt9L$h$AۉL$ht $$t $4u\$hNd@D$^D$_6_ 3V_ h h>VZO?QQuQQD$fPrD$D8?L$h|$lƒ|$< Шl$D EEU^_jPD$HG{{9D$<<reZ\$`vD$`T$@<ShUh>jBD$pL$PF^I$t $D$dWWD$Tx W\$xSL$xQt$xV$UT$dR$D$`z ==$\$d$\$@B| Jl$@L$`D$H\*u @D$Hu0D$Ht1؅z<AD$`l$`\$@T$$)ꋴ$$QRSjÍhwa$${Phh>W蹌1ɉƃl$`T$@}|$`DDA9rDPuUh h>S薍1qD$ L$ ݋\$`CfL$ \$`|$`L$@D$<<9s P8oY^D$PPS蛲jyD$ \똡M= T$ ;~ у  hh>QP )RjPD$ C 0v\$L$ DvjBXZjjGDÅkT$e j.[\$$L$ Q0vL$LAl$hD$d1Ʌt Å%sVjȀ9uM<PL$PQZqPh h>\$PSpĬ[^_]Ë_ 3VB h h>V=O?QQuPPhM<U n,$A v\$V1ɉƃ|$`T$@ol$`DA9rDPPU QPPh:h>E8W(@$览Plj,$?u {nZSl$dt$hFt$hL$`|$@l$$)͋$$RUWjH$$sPhh>V1ɉƃ|$`T$@ol$`DA9rDQhh>l$LU҈ hh>T$PR軈<Ĭ[^_]à hF\uID$`T$@L$$)‹$$UQRjHw$$sPhh>V1ɉƃ\|$`T$@ol$`DA9rDPhh>D$PPʇ hh>T$LR資4$0Yf+IZ``> hHF hXh>VXXt$V]l$ UD$dp t$PVXZjSD$Hƒ|$< Шt {{L$LAt kkA PK KB&u.9 jdXZ1ۈSD$ PyPSVhtF $;\$t l$ Ut Pv \$S t$1jhT?W$떉'WVS׃j~PPPjS艱Ɗ1ۄtt1҉Qhr h>V蠅XZhM<Sh$t$PPjVZ hx h>Va[^_Ðt&PPSVVh[ h>S@$PKt&UD$ t$SjjjD$4=t =*=D$% @TPcUWVS,1ɉƅҋ\$@|$D\PL$,QD$,PWͯ1Ƀw$D$D$;/PPSPPhh>Ss@$PD$(t \$@\$T$ t<\T$ RtPhh>UPhh>l$UL$(,[^_]Ël$ l$B:B$1t,4 WWPV]C$d  < uԋRRPKP+$3ut _D$1|$\$SUL$QG0VtƉ$ڴZWR._tQhh>V?u|$``D$ t>|$4_ 3Vy h h>V誁W?rruSShM<L$QtdZNjD$PD$*D$  PBw hh>D$$P9\$(CD$ h^tt$BT$t$QQWU 1ÅtRRhM<Pc$5|$WUt$VT$4RD$(\$u D$(D$; L$$QZv hD$|$GD$|$L$|$WU\$St$0VRD$(D$  Pu h P4|$:_ 3Vw h h>Vw?VVuȊ hD$#L$"WWD$*PVhh>Plt&UWVS1ɉDžҋ\$0Vt$\VD$PL$DQ荪1ɃƁ|$4#s;%iƒ Ѓ 1jT$HD$tH4|$ tPhh>T$R~ك[^_]Ít& $1?t,RR PRC$#  uԋRRPK1V$ut V1t"QD$S}\$(;#jL$YPjt$VW@X|$7S蒏Ã1t%PD$P|밍&'UWVSӉ$l$4|$<:~iPPj~RYPPSVVhh>S@${Pt 8aD$1ۀ>tL$1lt ^Rhh>V{t$u ; hD$L$PPD$PS^NjT$8t't$%u+t T$8 S|$0-|$0+ ȨQQWRRhh>Wc@$yP Pt hh>SzXl$ U[PPVT$ R3 hh>Vz[^_]Ívڸ+ă>PPjvD$ t$QjD$PjD$=t =:=D$ BTRJYPPjS蠥PPVD$ P~Zt\$un1st&PPhM<t&D$ jT$$ hh>VyރjPhh>j9xXSh h>jx@&'S \$T$jjjW=t =tZY[É=% @TPXt&WVS\$T$Pjjj=tU=tN1t:^ RZr h h>FQPxV6uʉ[^_Á% @TPPWUWVS\$$T$(jjj$=D$=|$1M_15t.K%u=PQV QU]RRPUŋ?u \$S1t@~ Q2q h h>VP(w~6uʉ [^_]Á|$% @TP"VWVSD$ tr8tm18untDGuPt&^ Rrp h h>FQhvV6uʃ[^_Ð1[^_Ë[D$ SSPQQh{ h>Pi@$tP D$ jjjT$4D$5=t1=t*D$u'Rh h>Pu߃ D$% @TPTv'WVSt$t8u1[^_QQj~PN1Pjjjs==1tft$ƍt&^ Pn h h>NRtF6uSShM<WWƃ W[^_Ë~zORRjR6 h8 h>Pot"QQhM<PHW^ZjP|I hH h>S7tw ATQBSWVS\$ t;u 1[^_Ít&D$ WWSVVh h>S@$zrPYD$ jjjT$4D$=tz=tsD$uLt?GuW^ P-m h h>NR#sF6uʃ[^_Rh h>Pr랋WQQjS裥$諨vWVSƃӍD$|$(PV7T$ D$щƒ!Ftx!FucPPsPPPhah>KR@$qP1;t Y SgƅtwWhatnQhh>V#$pD$$XZSVRo^XjjjjjWT$$hh>Sq[^_à VtGST$RWVQƋ$Åt>t  Vg렃 VnG1tPtPHuHui1| M 1ۅQQPRRh[h>P 10 Sh VhRjjpVhƃ5UWVS|$,l$4Wƅ gPhh>V(p<@<*k V肓  01ۀ ~u1Ҋzt&ۉW hh>Vo [^_]à PriPhh>VjoBD$$t T$$tE 1[^_]V肐]M_{ D$$ÁtsT$$gPPj[VP@t^*x]…%t&{Á{E{x]uL$$…%tˋ\$$뿐t&UWVSF Rd hh>FQj~T$t$ Uz14$ut$t l$U|$tD$=D$t$D$0t}ttGt;C \(U׃uph1 A uŃ =W<[^_]É{Nu+ S-@t +ru+rt-^QQjW h;h>W3i^^?~RRjW” h@ȋ\$ t$ t$T$RRj{~Q۷t΋F SFD$(D$BvPPT$(RUs D$$hh>\$$L$4CPhl$(\$\tF S贜~ŋ 8 uPPRSuWU댃 |$ WUhh>|$4Whl$$t$$.t$ t$$t D$0PL$ 4D$ D$ |$ |$,t$2N Sa h h>~RgF6(uʋt$N D$8PXt$ Vw Tj`FN R"?ŅH==E11ۅu'=f `utD$ t& DCPbYZHHWP`TDžuӅtRRT$RP\$t$D$ Pa\$t$ l$,UD$ ` L$QfD$~ Q_ hh>FRe~E5d@yPhh>jkdphF TjDPPnuVhi?落 j.vD$D$D$ t à j@ Ív'S \$j6hFRd j7hFSd[Ít& u QQhPS  ÍVSS $vt u 1[[^Ít&RjPD$Pƃt܋^u*PjPhF^S,d jQhFVd1[[^Pj6hFRd j7hFSc뱍&'W$vVS\$|$ VjQSƋ@tnRjkhFSc^PPWPPjqhFW@$=bPV|$B?/tB|$~[^_ÍPPSPPjnhFSf@$aP FjohFjaÉFc j@qt&W=$vVS\$t u1҉[^_VjPS1҅t@8@truހ>.u ~/QhhFV$,a.@/XZSVR$څuQhhFS%b?.t2PPWPPhhFWP@$`Pƒ[^_RRj/W)Åt"jjWh1/PPWPPhhFWPPVSShhFV@$Q`P0*VSSS\$j4hFj *`ƅu@Qj9hFP `1҃^F&B9|Z[^Í&'T$1tBÉUWVS 1T$ MD$ XPj4hFj _ۉD$4Pj9hFVq_L$lj1YA@9|\$ 1SL$ 11ɋ1ÍvPj]hFj _QQƋCPPPjahFSRb@$^PSF1tL$$ RT$4K FCN Fs\$ L$S E9~D$8;@t$ |$no [^_]ÍPjXhFjA^D$1PPRPPjbhFSR@$^PT'S1ҋ\$ &CЍBB1Š u[Í'S1ҋ\$ &CЍBB1Š u\$ K[I!ʉÍvUWVS t$$D$(L$ 1) t&A<^Ɗ4^1uD$$xO!t 9s tau1D$(UhhFj\T$4l$4p @uF@ u|$0x [^_]ËC8uQQT$(RPzuC@CD$$X1 [^_]Í&UWVS \$$tfT$$B$tXL$ 1T$ t&A~Ɗ,ލ4n1uT$$1j ML$!t 9s tߋu1 [^_]ÐCL$ 8uQQT$(RPu΅t37 $l$$I؉M|$ UWVS |$$D$(ut o1uvL$ 1t"A,Fފ4F1u_UhhFj,[K!/T$0q AwDFALQw [^_]ËL$ 1)t!A^ƍڍ4F1ބuOI!t&19s tC8uQQL$(QPauߋsFst&Pj4hFj aZ j9hFhKZC@C1ҍB@|UWVS l$ t{MttU1~cE4tMT$$t` 6CPT$4 h2hFKQZ h3hFSZuUEG9E [^_]É6Rh1hFSRZ h2hFCPZ h3hFSmZu땍t&S \$h@hFPFZ hAhFS3Z[Í&'UWVS |$ l$$tBGt;W1~1t(9~$t SՃxuWt&F9σ [^_]ÐWVSh4 2…tWWD$PR{u 1[^_Ët$ x 1jnL$ T$ t)؉9| 9r[^_Ãj.Í'UWVS1ۉT$Pz59};=D$ C9}( T$ 8uRRUPzuމ &DžxfPP\$xSU u1$$4$^ F$VNVhhFUaX[^_]ÍN hhFQPW hhFjV1+l$ t8PPl$UUUhhFT$(R"@$VPCRRL$QS u2 D$PT$<,t$@EU\$Xu] [^_]Ë,E EEE[^_] S1ҋ9}* B9@ @@@|[Í&S1PP;}Qv PhhFPVJuBRhhFCRV;|u7Y[[ÐPhhFBP\VRhhFPAVY[[ÍSPP xqSh)hFQI $Tf@l/var@/mai@ /XC ZxqRP؃[Ít&UWVSD$h 4.Ǎl$PPUW]Åttt&1;&1Atc9t^u<\t\utt&t Y[[Ëu뼍v@%uɨtŨu;t7t,t't#P tPh hIR\H࿨t W7/P #Ph hIRHv<P 7PPjS$ZYPS$< PPRS~$ SPP\$ƒA ШBC Ȩƒ@%t<P um@uiu<t8t-t(t$P tQh hIRFAtaXZ[Ë@tOXZ[PPjSh#iPPjSO#ZYPS?#<%&QD$HtЃË PPQPPhhIR@$DP} D$(L$YXjhD$$ugD$ D$tA|$t3|$t,L$tD$ T$ ЃáPjhIT$$RPPjh葮D$ 낋D$ωÍv'VS11ۉD$T$‹;@3T$ P \$߉PPL$QPPhhIT$(R豮@$0CP\$,D$C D$$L$  L$ Q hhI\$ SCT$, uzD$t:T$PhhL$,QtQQjh藩؁[^Vht$(VhoY[jh٬ƃ'PhhIT$R2CD$, ߉ WRjT$ RD$P&'IUWVS$|$T$ vF@ t U誯<$袯Y[VU٬ WUj]v =P RPVhIu6Cw `vuIQPVh0JŝXZVP$謰FPjWjҬ@8t$ 5[^_]dPjh%= RRRh@hIPΫ@$M@P,Pk$S hBhISPAWI\<'VSR\$@WtLHtI 0@tt=p t*u˨0X[^PPShIPX[^ډPPjh覦&' 1ɡt@utȃ úIAuH҉ƒ%tϡtƉ QQjh4t@utúIB SQQ t@utXZ[úICXZ[É'S\$RSz[Ít&S\$PSJuu-࿨t XZ[ËtȃtÅt=P tQh hIP>뢍v'VSP0 tFt*t%t!P tPh hIR>t&tx<t{ SփC@~ܡHt 5Put Lut Pu5 5 X[^èt댍&PPjS|VSP` tFt*t%t!P tPh hIR=t&tx<t{ SփC@~ܡHt 5Put Lut Pu5 5 X[^èt댍&PPjS|VSP\$@AB@|tqHtn葤 A0 tt =p K0Z[^1Z[^ÉuPPShI賓ͺI뷡t@uuIAHۉƒ%r5d PPjh詡B@:2IBez QQjhYD$ÐD$ÐD$@ÐD$ÐSPP\$9t uVPhh@SG$t 蜢8tZY[1҉B1@ZY[ÍSL$ƒ ЃuCʣ@[Í'D$=tdu p1Ð1Ð&T$=t du 9 pt1ø9uÍt&'SQQ tKD$t@SC )1҉ uCC 1[Z[Ít&؃jRPPЃ[Z[ÐUWVS|$D$RPWj謨jjjWգx!T$@D$<| ŅufPhehzJU7D$ hhzJj759}= kMt$ ;sCC S؃|[^_]ÍG hhzJPQ75  t&B9|=-# W1돉jL$Q x D$ 1 Ð&VSQ\$t)C3u$PhhzJS7 [[^RhhzJP7ƉUWVS 1|$ t$$999 D$= t.S+&PhhzJS7 <1ͅt+PhhzJj5 jPW؋ Dt0l$t<PP [^_]Ív91hhzJP P5ڃ B9|D$=95D$ V QPhhzJKQ5&'VSQ\$t5C3u2QhhzJS5 t$ [^I1Z[^RhhzJPy5븍t&VSPD$x{;}  uD$X[^&tC3u-PhhzJS5 4$›[[^PhhzJSR4 [[^Ð&UWVS |$ tu]\$$t5 ,u~=-E-9= p RjjSM؃ [^_]ËSC )1҉ CC \$$uPj jW lVVShJ蛎 4aV.PhhzJV35 =3 Sm;= t4txN.PhhzJVh3 ,$M& p؃jRPPRhhzJFP3$ W轙 qPjjWʞtsPPWhJV[PhhzJVR2& SPPD$=tdu9 pt1Y[[9u~QQjP@%YH[[uѡ t(t"SC )1҉ u1CC 뢃Y[[؃jRPP輜 S \$T$ [É'SRR SC 9tuAPSRCP QA~=C CCC%ZY[ÍC1Ɋ BCZY[ËKC uCCC& L$tPuJP@ ÐS\$SL$$$Qjh t R?([ÐST$RD$P[ÉSL$Qj`[Ðt&SPPu[X[PPjT$R[X[Ðt&SPPuXZ[PPjL$QBXZ[Ðt&SPPuXZ[ËQQjjXZ[Í&SPPuXZ[ËQQjjtXZ[Í&SPPt2\$=u1QQjPXZ[Í&'hhJj-L$ HT$$PÍ' tPhhJR. Ít& D$u!)v PhhJR g.u ÍVSPt$3&@u S8 t(RhhJS.ÅuX[^Ðt&PPVR菔uQhhJS-X[^Ð&D$HPQRP衙Ðt&VSPt$+&t S8 t[vPh hJSo-tbCt=$ t SRЃQK CQPSR%PPVRǓuVhhJS-t&[[^ÍSSStBvCt=$ t. KQЃQh hJS,uXZ[QS CRPKQ胘lj'WVS\$|$3Rh.hJNQ/+ xp @$ Í@VWP2[^_Í'SD$PL$Q}[ÐUWVS(1\$.tK!t6xwtQWV QϑHu1 u[^_Í&ÊFt <.u~u1[^_ÉUWVSà 1 T$@u @11P[Njt! PT$tK F EutN1ҋBuPhrhKWE([^_]RhahKFR((PhihKW ([^_]Ð|wD$uÐ( VSPPt$h%hKV@$z&Ê11҄t<tgABu PPjS= hhKSh't(t |wuXtIt/ V\Y[^Ív|/tB\AtASh hKV'Y[^ú( 뚉'UWVS(D$<S=ŅT$0Z |$0GGtPËtPhhK Ry&uPhhKt$<^SX&L$@AY u3t}ua[^_]Ð 8uQQSPŌt`PhhKS%|$@G 묋t$0^ 7[^_]PPUWWhhKU 1@$$PgT$@D$(D$$B D$ PPt$ VUPODžtk&CT$D$9D$0[ p<3W舏|$0D3D3Wu:\$PPt$ VUNDžuD$0l$0[x][^_]à Q҃\$븋L$ xT$L$ hhKD$PT$ Шu"=€! Шt{=ta-t%1[Ð{u[Ív{u[ÍvStԀ{u΀tt7KetM1eultgu[ø{u[ÃnClt~׃n{҃ft1qt[Ð&T$1:-tÍt&BG3w$L1øÍt&UWVSÉ֋l$0D$4t*WW|$WP~D$T$1\$uH[^_]PPD$PS<<PPL$QV<I1w$pMQQWVg~D$T$1T$tЋt$ L$\$$9|9v1o|$t$ $l$11 %MD$T$ $t$11 ܋l$ |$\$$99 1t$ L$\$$9n91l$ |$\$$9=91PPShQ/3[^j|hWWVىUWVS$$=t|^>€< Шt7u3>MPP$W$Q;[^_]É!t}F€< Шu9!t-u {QQShL/XZj|h{{ujTRPS [ ^_ÊCt<=y{tnt&{=u{u뭉Cu Ш|$=€|$! Шt {=|$-uASt:{u4tCƒfq*Clnt&SSS;} 8-t ZY[Ðt&xauxuJ …%!ZY[ÐSSSX 9} 8-t@9} 8-tZY[ÐxouxuB Z%Y[ÀxauxuB …1ۈˋ !Ӌ뉉W=V5S\ =<€> Ш|=€! Шt {=u-D8-8!:(u L9)MPPTRhLH#^_|jh(p{z‹55[^_À{t@Sn{dt.C \$ÁD$\$t$@  € %t|PPVhtRKueD$@ \J'€" Шt3S\$@ t\9t B\$@ uӄtCt$@ o\$()uL$@T$(<t BT$(PSD$HPT$(Rbjt$,ZYj\VJT$1ۋD$!À:tu t  t$,VeËt$()B9|$l*29}h5heRUT$,RD$0PVL$HQD$,Si3BBCCRRRhmR!J(BB t$@<>ShheRl$(UD$0<[^_]ËD$@\8iDY>VjPt$(V@ xWdZƋT$,RdD$ D9|$l.29}h&heRUD$,PD$0QQWD$,T$PiÅtL7 À  بu=D$SQQ\$tCuQhh~RSXZ[ÍRhh~RP̍v'WVS|$tWGX 9t+s tCuCPhh~RS\G9uՉ@@ GGG G[^_Phh~RSR뤐WVS|$GX 9u$It&Phh~RSG9t*s tStPhh~RKQ뼋G@@ _GGG Gtsu)Phh~RShPjdh~RWW[^_Qhh~RCP<뾍&UWVS t$ l$$|$(t.VF t"FX 9vPPWSՃx[ 9^u [^_]ÍvUWVS |$ _L$$ _ … Шw1ۋn 9 vI C9;\$$%u9qF GH WQ_9t%D$$‰$T$$t$)qI 9uD$$)G w)GwD$(t1t)m t{utPhh~RSuؐ1 [^_]D$(udE 9 ‹@ 9uB _GGG [[ GQhh~RSRptY 9tDk tsuPhh~RSQw9Phh~RKQ1ʉvv GGG Gt&UWVS|$tyG G tqw1ۋn 9CI 9ƒ%u9tNQB wN _YG&QI 9uG WGW[^_]1[^_]ËE 9‹@ 9uB OGGG II G벉WVSt$tVNtOVF tCY 9 {[ 9^t7 {WKDžtRh'h~RCP1[^_É[^_ÍvVSPPt$hh~RjwT$$ËD$ S1t*PPVQQhh~RV^@$AP dCCC Z[^Í&'UWVS 1|$ l$(t$$Oq toShh~RjZY@UPPhh~RU#^@$PcCG WCFC^X s OD$$‰$GWT$Vv 9uG [^_]ÍvUWVS 1|$ l$$Gp toShh~Rj ZY@UPPhh~RU_]@$PbCG WCFC^X s GGWt&Vv 9uG [^_]Í&S j@h~Rjn @@@ @hh~Rj6@ @@@C؃[ÉUWVS 1T$ UPj@h~Rj @@@ @D$hh~Rj@t$ |$L$@ ^@@GFY\$ AT$ .Ct$/j H z9ȉn ~L$T$rjPhh~Rj/ljp1t*PPUVVhh~RU[@$P`t$GG GnEx D$ NQW^{no |$O 9HL$]D$ [^_]Í&'UWVS T$ |$$l$(Vhh~Rj`8h\$,D$1t2QQL$4QPPhh~RD$HPZ@$$P`T$ \$rCCC B9~Lt$ ^\$s 9-v^ډ11 tj9|9v 9t$uԃ [^_]|9st$ N~F QL$VnJ FXYVJFA 1 [^_]Ë|$t'T$jUhh~R\$SiShh~RFPR1T$,t2UUl$4USShh~R|$HWpY@$P^Fl^L$K Yq Nt$ F VHPhh~RJQMt&'UWVSL$t8D$hx t(\$s^ SL$1ыT$1 t[ 9u1[^_]ËS sD$rshx hV |$PD$11 ul$~}M[^_]Ív'UWVSL$|$l$t,QA t q^ S11 t[ 9u1[^_]ËC[^_]ÐVSPt$tIVF t=F1ҋX 9t+PPRKQa $i#[ 9^u߅t0u [[^1[[^à P轈[[^ÍUWVS 11l$ \$$SPWVU}u [^_]Ít&UWVS 1\$ Pj@h~Rj @@@ @hh~Rj11@ @@@ESPWVUu [^_]É'UWVS l$ t UE u 1 [^_]Ë]1s 9tKPPNQPYXWS$! h(h~RS v 9uut7u [^_]à W1뉍UWVS T$ tt$ ^F u 1[^_]Í& 1T$,j EU|$0ŃOY DS1Ft1PPRPPhHh~RRU@$"P[T$ JD[ 9uD [^_]ÉUWVS19։T$! \$CC[^_QjChRPC{C CtōvRjJhRPCCC[^_ÍUWVSt$(|$,l$0SVеÅ@uL@u;taPPT$4RSƋCt:UWVSЃtWjuhRV [^_]É V?VUWkU4뾋s:D$tVjjPKu@t$SsC Cu:CCM V:RjChRCP|PjJhRKQfC멍v'WVSt$ V萵ÅtvD$tC@t 1[^_ËCt[^_ËsTtVjjP3SuWs{C Cu"CC뱃 V(ÃWjJhR{WCPjChRKQ듃 V>1L'UWVS 11l$ \$$ED$t&WVCQU҃tUuߋCQWVT$RMփ [^_]ÐUWVS(\$@D$WhH hhRS[^_Í&PRu{RPRhKH[^_ÍVS t$j[Vo+1҉Åt V1[u Z[^ÍQQjS6ƀ<]ƒ 1Ҩuй9}v < <  Шt A9|1먺롍'UWVS|$(hhRW WRL$(QPJD>XZjV_]\D$PS> hhRSljr hhRV_\$t [^_]à j脺t&UWVSj\$0SNjL$$<]… Шt$$>\$$ @€* Шtl$$}wPhhRV Wl$,UPI_]D3jSZY\L$QP= hhRVՉl hhRSYT$xmVUW\$,SRvt PF 1[^_]à D$,8Wz1 [^_]á@$PC[FL$$t\$$D$(tt$()> [^_]ËD$$zT$$kUWVS \$SD$PL$PPt$VWƉ<$A넃 L$APǃ1u3 WDʼn$ hhRU맋L$tD T$*U.1 j螮 l$U.1|$ Gt$V.\$(1C[D$T$L$ Qj)Ðt&L$ D$QT$ R1Ít&WVSL$ |$(QT$RD$,P2Åt- P hehRStNt 1[^_Ív\$ <@<* Шtހ{]u؃uFPPjh $ Ƌ\$ ;*uu6SSWVlj4$@?돃 vVƃ1us V脲É$ hhRS뫐UWVS,ƋD$@D$ D$$T$D$ D$D$ tQT$ C\H$d|$t;;L$T$%!‰T$:w5C ut$@ȉ,[^_]Ã"ƒ' ШtECL$ύvD$L$ )؋|$ l$$QPRj7@C|$ l$$둃`t$Al$;L$D…%{etDD$ <  Ш:DD$ <  Ш |$ |$  |$ }CD$ |$ƒ|$" Шt]CD$ |{ƒ|$'%L$CD$ Dl$El$6~'|$`B떃{t~l$}…!уT$7|(KL$UU\$$SV\$, ChhRP?|$ |$ |$G|$&'UWVSD$T$Zl$9 t$$VP1D$[\$ S?D$ hhRL$T$ʍPfD$ ;t$  1ۋD$L$$,U4;\$}^PhhRT$ Q4D($ XZT$L$ PR9XZL$CPFR9;\$|QhhRD$T$$ Ql$\$ El$9\$KPhhR\$$S,[^_]à |$$WW,[^_]à RFt&UWVSx$D$lD$pU3Y[‰ƉD$dj{|$hW j]hRD$h@PD$H L$`QUP~7D$lT$H jahRjL$HD$<@{tD$,l[^_]Ít&\$\C\$\PPj}WuRShhRt$DVXZUWWhhRU2@$OP.8l$<ED$,l[^_]VL$`QSUCeT$l)ډD$DT$@1ۋ|$4D$`D$db€\; @xN[5C|$4uRRht$@V21҅tpt$4)PSj|$@Wd ǍCL$4QPT$@RdD$?t 8+Vh>hRW h?hR|$(Wi1҉օD$,OPhhR\$@S84$D$lōM $‰ʼn,$D$<T$4D$0L$`)؋t$`|$dQPRj1ƒ@t$`|$d\$4D$@D$DD$ D$<1ۋ5@xPPV|$HWT$@D$D L$@D$QSD$@PNcZD$PT$ ƅ \$S4$ZYD8PT$Rx19ىD$ }A9|L$ WhhRVVhhR|$W3\$1[^_ÉUWVS5=-D$ j  |T$5=-[^_]ÐVSP\$t$~|[tz)%t|(t21҉Z[^À|{uЀ|$uɍTPPj}R uQQLj)Q u벍PPDj]P ug ( =p hP4uÐT$$p % vHxÍvHx$Ít&'Hx$p hs3$3Ðt&Sth3RY[Ph3蕜$3$4-Åt8uh[ÉRPSj'u Sy,h[Í&VSd1ۋ t$pu ؃d[^Ív軈; ~RPVjo'@t4 PPVS蒹 5,΃5, $Ã8uPhjAV'x P"띃 RK# PVhSN&VSd1ۋ u؃d[^Í& h4ƅtۀ8t։RPVj&@tt>蹇 9} 4t=PPVR蜸5, ։É5,$3 i V É ,PhhAV&o Pq!^UWVS Dxt$ t =3v 0V蝈= G=  [^_]Q8U8CDžt Sz$ Åu |\PhhSVM$,$B$D$辸4$U/Uh)SP( BUwVSP6 hhSS豹9 Vm [^_]~i]5|\aD=KQ& H h3軑uЃ 褅 ƒ ʉÍt&L$tt <\t <&t Bu1BBAA1ÍD$LxvSSS踄Å謄1tZY[UWVS @tt T$ : /I=Tx1X=P Qt$(VS!PxH%DE 9-Tx~?PxDt4ރ/j Qj&VyVruk@|$$tf 0T$,R迅- E- z [^_]Ph%hSSlG1 [^_]Í D$,P)12tL$ 81vt6L$ 8uPPQRuF P͇Ńu謂QQVRRhhSV @$iPH&)VVQR%YO'SPPL$0=~)t28u t"L$XZ[mSSjQcXZ[É˅t؊t< <  Шt Ctut;#u̍&WVS$t$ u;= vt1t) L$ :D$ 8Bu|$(tyHxtp;tk0=tJ 8u45u*لt< <  Шt Atut9#t SR؃[^_QQT$RV虠ÅtUD$$t< Ȩuu u5<Ku \$ D$ =t1q PE 1^PPjSEPD$=(Ph?WltiPhhSD$P =(tLs=f VhPP|$WhO=Du|$ ?t0=~hd 8u@u6t0< <  Шt Atut 9# W PPjWoSQQ\$u%P h`u0 Pj 9[Ít&RRhUShWSōv'WVS=dx\$ttdxeSuti;ta RRj@Q…%u…%[^_dx=느t&uA5xPPVSSxh!hhSSC@$°P![^_Ë xxPPQPPhhhSR뽋 Ph+hhSQt4$eƅuFt<@t1BAuPh?hhSPW5hB@^PPRS 뿍SPPtZY[à hyGr ,`(jh hsS S虅 jh hS腅 jh hSq jh hS] jh hSI jh hS5 jh@ hS! jh hS  jh hT jh h!T jh h6Tф jhP hHT轄 jh hfT詄 jh@ hxT蕄 jh hT聄 jh hTm jhP hTY jh hTE jh hT1 jh0 hU jhp h$U  jh h7U jh0 hHU jh h]U̓Qhh j hh j^ hh@ j hh jߍ\$D$ D$ jhS聅= D$ PjhS`= ]PPhj脄 hh j{p hh j/\ hhP j/HD$~D$ jhS= Phh@ j~ hh j@ hh j@ތ hhP j$ʌ hh j$趌 hh j!袌 hh0 j!莌 hhp jgz hh j*f hh0 jgR hh j > `    hh j  hh jv hh0 j@ hhp j\ hhp j*́ hhp j=踁X dxQvUyUP  pjZY[!Phh S݈PPhj 'RRhj V' `     Í u1 à Pe8 hhhSRLl1 SQQ\$uGPPSPPhhhSSC@$©PllP 1[RhhhSP踪룍v 86 jXZRj fXPM1ÉUWVS$hd$PD$(Vt$Vh$U<1튜,t0 €  Шu   Ȩt E,uЄ€# Шu$ 迒UD$\$t$ C t< <  ШtFu% €  Шu €  ШuC uՉVt$Vh$UG \$SO[^_]ÍKЀ w6   Ȩu"E, €  Шt̄t$E, €  Шu   ȨuԄ€# Ш@, €  Шu €  Шu E,u9u uS)S$PV=D 9~(Ѕxu  RRPQZPPVWWhehhSV%@$褦P=B,KB농v' t  à h3ttڋB à hUu͸UƍSPPt:1;}& PhhhSCR;|[X[Í xxPP)jPbmxl1 ÍvS\$SjIrxt/;|'l1xl ZY[áH9~ԍClx1l ZY[UWVSNj -t$,L$RjkHPh0hhSV$菤WVhUP Wj$t$(tUPS-ǡPl$-L[^_]5q PS$=z B qXZVPPh>hhSVK@$ʣP:&D$T$h@VjÐt&D$T$hdVjÐt& $_D$D$ D$ PΠt8u1QQPRRhuhhSP@$P$1Ít&D$u t u1Ðt&@Í&VSVt$1ۀ>$>~%dxD$ …\$ \$u >PPh V`Åuw  Vt]SShp V`ÅtGpt@= u7 1P'v>@_PPh V`HtZ[^Í|$'t~(twQQh VV`Åt&H)1 8RRj/VPPh V_ÅSSh 뇍vUWVS  \$$$KD$x Pv< <  ШtKyx>5P "€' Шt#ɉL$t&Kx  €  Шu1A=PޅtP<`T$ <`t;4$…tpz $I$ [^_]Åu%u{$1595fݛ=9=1 P<t rPQhUVP藽;D$$~PhUP\$0SRu Pǃ1C< <  ШuPPhUSP= PPSQ<9D$tVh6hhSS蒟D$t t SSh |$,W\D$D$u  $  UT$Rt$ Ш1 T$RWVt$8VP. Sh,hhSP`&UWVS t$$6 L$,QD$ 8~ PPl$(UWWhhhSD$5$ $GC9L$8uRhOhhSP蔎DPL@P5P҉\$ h3ft\B1] -EU51ҋ59}B9|멍EE hUfeU[t&'UWVS l$$\$ u]T?`QQSRRhhhSS@$ P TPk\j\XD$-\D$tF\$=T 8tzT$Z3tt8tPUVWuD$|$l$tNPPVPPhhhSV@$@P [^_]PURW[r뤍UUL$ SVVhhhS1VkWhhhSP+1 VSSL$\$uRdPPSPPhhhSS@$膊Pe dPlãhtw5lt d8uPVRQfuȅtKPP3VVVhhhSR@$PZ[^RhhhSP41Z[^Í'UWVSPPދÅ=59 PPPQSQubPhhhSS葊u:;=}%-P=T=  %u~1 [^_]Ívj5jjjMX5ZVj-$@jjjj=PPjj o=<Sjjh<< 5PjjV=<;PttUhhhSPn WWQj 3賥'UWVSP5<j<jSI5<9؉ 3=9ߋ P%PPQVu`PhhhSV迈u:;=}(-P=D=< < y1 [^_]Ë==jjjj}XZRj]4$@'jjjj7?WWjjDtQQPRRhhhSP/@$讆P=<Rjjh<< 5PjjV=<;PttRhhhSPmPPSj 2貣&UWVSP-D$ 5<j)j<S85<9؉6_=9ߋPL$PPRVkPhhhSV视t$t<==D$t)WWj j21 [^_]Ít&;=}ȋP= ; € %tPPjji딍t&jjjj-ZYSj 4$@jjjjQQPRRhhhSP@$qPP=-<Wjjh<<Q 5PjjV-<;PttUhhhSP0VVRj ut&'UWVSP5<j<jS 5<9؉ V赅 h~hhSV蠄ti=59 P%PPQSPhhhSSV== 1[^_]Ðt&=5<Wjjh<< PjjR(5<;PttWhhhSP҃VVSj  [^_];=_-P=D=< < 7PPjj$vj5jjjmXZRjM$@jjjj'QQPRRhhhSP2@$豁P&'UWVSP5<j<jS5<9؉/ Vu hhhSV`=59 P%PPQSQhhhSSX5PZVSSPhhhSS9@$踀PXZjS#ƅtPhhhSS蹁 V%f4$ P^XQS4bPhhhSSp== 1[^_]Ë=5<Wjjh<< PjjRG5<;PttWhhhSPVVSj 6 [^_];=d-P=D=< < .u~& hU裛XZSV hhhSS{_XjUiDž| U;|/0ShhhSVz$ 9h hhSUzD$ |[^_]Å=SSVQQhhhSV@$SyP2XZjW~Å P^$ƒE18%D$ UhhhSVz hhhSW z$3$3UUj`VwWh=QV]ZPVuV8 WÍPhhhSRWx/DVhhhSUoyPPRVfShhhSW4y hhhSV!y hhhSjw$ UWVS D$ \$$D$ pbxEŅ1t 0VP1ÅlFQA A9~Ƌ PPB PQ藫 럋-=h jUW\$ xS?t|p4unvtg t`tpQR x5pPQuˋll$$PhJ hhS|W@$EvD$0[^_] 1[^_]à R,iPh- hhSSwGDXVSV5 = t! j 45[^Ðt& j?45[^Ít&VS5j? 45[^ÉVSh 5$ 945[^Í&UWVSh 5= -$  U35= -[^_]Í&UWVS5= -j?  UR35= -[^_]ÉVSh 5$ 25[^Í&VS5j? 25[^ÉVShP 15$ i25[^Í&VS5j? $25[^ÉVSh 5$ 15[^Í&VS5j? 15[^ÉWVSt$|$ |f9tgPPjW轞ơPPVSSh hhSV.@$qP VÍ@h hhSP~qZYVPX *D9tPh hhSVsr =WJ=||t[^_@Í1@[^_PPVPPh hhSV@@$pPL&Sh hhSPq&Rh hhSPq&|3Qh hhSRoqCWV=@Std = hp 5$p //5=[^_Í됍t&VS5j*p .5[^ÉVS5j?p .5[^ÉUWVS l$$;}' P< < % &~_PPjBj 5SPVS Åt. Pu Ph hhSSo* =?\=@U = hp 85$p p-5=*\ ȨuO [^_]ÊD< < uECPPUjO5Ã*\ ȨtWjjU؃ [^_]PPjEj%륃 5p j*,51 5p j?t&UWVS\$,Sg @h hhSPl|$4Ńƅt,t&t&\tKt'9t7FCt ut& [^_]Ív'€" Шt1Ȑt&CF;u [^_]Ð&UWVS 1\$ t$(;~ƒ|$$%=|xƒ%" 'u> vt- $u#PPj!St";\$ tQh. hhSSlÃ% U ƍXh< hhSS<:C €:%us|$҃"t tC \$1t&NC1 ux9mPVRh V8$ >:TCÊ  €  ШtC u"€' Шu1ҍ|$t tC \$1tC1 u9PVRh Vux5PRL$QV+5VPUj;B\$Sh UC1 [^_]Ê E>t&\t+9nC ^\t,9C t&C 6ZC yPPVh"Vi UWVS 1-D\$ t50 S @h hhSPeʼnƅt)t#\t{tW9tgFCt ut&WWh U`# h hhSUet3u> [^_]Ít&'€" Шt1또t&CF;u듍vغP $ [^_]Ív'UWVS \$ <"<' ʃu1 S @h hhSPcʼnƅt$t\tFt"9t2FCt u [^_]É'€" Шt1͐t&CF;u [^_]ÐT$1 щ…uÉ'T$1@uSL$\$ ؅tʋ‹u[ÐWVS1ۋt$|$tXT$t 3vCޅtCފ 8uPPRWuߋD[^_Í&Qj W QHuCޅu[^_Í&' 1ҋD$L$8 9Lt B<u1 ËЉD$RjXhVP@$]bD$ 9WVS1ۋt$|$tOT$t *vCޅt:ފ 8uPPRWu߉[^_Qj W QHuCޅu[^_Í&WVS|$t$)PhhVVRa VD$WSD3؃[^_ UWVS(l$@U_11D$t$DV1D$ D$0D$D$8tzT$ ҉T$\$tL$L$4T$08*t__9|)9}hhVVL$ QaD$$T$0ET$ߋ\$0<+ut$>[^_]ÉRT$RQPu\$ t L$ 9}7T$8 \$BGuL$tBT$Ջ\$<%D$낋T$9}hhVVD$ P`D$$EUWVS T$(\$ t D$(8D$ Su L$hhVtV_ʼnÅtYtS;D$$\)C9|9}hhVVU)`ōTGZtu [^_]D$xWD$xE PD$0T$tKL$,)u_T$9|9}hhVVU_PP\D$0PSL$˃GWO;L$$ D$4P uPPj\T$4R}t D$4P}5D$ PD$ ؋L$ 9|9}hhVVU^RR\D$PS(L$ hhVT$RS_6t&'SL$ \$xT$u < <  ШtIyD [À< uIyD [Í&'T$D$D$T$h=ju ÐQQPRRjDhVP@$e]PD à t%8t t8ut8u à D$P6΍'UWVS \$ l$(;t8u h3e6tu8tpt8utkteCtZPtcQhShVD$0@P\XZSV^tT$$U [^_]ÅtE 1[^_]á뉀xuVhDWvUWVS 1l$ t5Et. FCt$ tF"€\ Шu u߃Cu܍NPhvhVQ["Xt+vt! t4"ƒ\ Шt\C CFu"C [^_]Í&\CnC"C C"l$$tNjD$$F뻐t&UWVS1t$,\$(h)hV@P[\$ǃBL$ D$ \=ET$9|/tO51D$tVtP FCtH tBF"€\ Шu u߃ڀ?T$0t D$0 [^_]S^hvhVS\ZÉ$C"t2t+v tw"ƒ\ Шt\C CFtu"Ct$ Wu= T$ RPL$@QVV*Y[PhWhhV\$ SZzL$\CnC"C C"tD$wP\$SUW hhVWZ|$0t l$0L$M [^_]PPWh\92D$0t$0.WVSS8JWWPj1҅-t8u h32t8ut8uVVPjt8u h3>2t8ut8uSSPjmt8u h31t8ut8uQQPj&t8u h31t8ut8u1RRPj5~9|[^_áv&zzC9}‹Xuuz܉PPShU裧tz5~z봋5~뽍t&'SQQ\$uPtdPPSPPhhVS@$WPt8uC[X[&RhhVPWuPhhVjV1ZY[ÍUWVS T$ \$$:Tt-BUJL$ J'UWVSj jP襩DžQjjV荩D$ jj W*É$Їʼn=tQPWjV‹L$ɉƒ] Љ-u1 [^_]Ðt&RWjjPjjWك hX苙ƍvUWVSxXދx Oƒ Шut.$X& S觅@t ppRRjP7rTÉ$#TƉ$ot VUe[^_]; VP ^XQSIƒ ШPjjS荧Ht t  Gw S0t&1e[^_]Í V4$}9- Qn\ Wm Pj jt}WhhtWV:A qӋ zNjBAR&y'Pjj R`@ VB@t XXRRjPoTÉ$T$tz RDž@tdu V \t4à  ب ƒ Шx oYPjhxVPhhtWP8it2;PjjV脤@ P;tQQVS֣ƒ  Ш%;t%w  Ȩ< S wjS PPjj:G躟=. R^SPSjhW^Ct^$FF PO PPRf19}u‰Ӆ,ShjSɢDž RMXV(VhhtWSd6t2;9QjjQ@A Sr;tPPPV`LPPSVN;$ V PPVPVuS~> }P=Wj dF F $Ɖ 11 u 낃 SKRhhtWW4: t$SjVQR {PŞ )čT$PPY;WP B R QZRQp\6PPj Ë0Q hhtWP3XWm3賛,PjjWq@PjjVF@yU'RRQSd|tƒ  ШQhSSSSjRRjQh VÅ[PPh:HS<1S :W蛜;tPPPj RjVW YQ~u P&XS) SoPjjV艝 RBXQ赘 hhtWPd1dX Ë0W hhtWW*13pPhhtWS 1Pjj WsQjjP襜1R5VjZPjj Q$sPjj PrPPjjR PPQSWhhtWP/WWjQ$Å=84Džxt"Džxt PQVSR;ۋ8tPhhtWS`/1;t ufu SZMPQVjNuE%=t-؀ ShPSÅxډл踖8u؍t&Dž蔖 8V9 nu WqXVlcRhPR7Å(PVSj芝uH8t4E%=t%MVQRVSڅ Sb誕PjhUWDžmڃ8WVS|$tuCu3\$0ƅu u1[^_WWPS[^_ƃ P謝t؍t&VST$ 1t"t&J 1Zw $X1Ƌu[^Åۋ%ܐD$Ít&S\$SS[Ðt&VSPt$^t0tDt(Phh YS',FɉY[^ÉPhh YR+ P_몍UWVS \$ t1;t+st$T$$t0t*<\t"<&&B鍴& [^_]ÍBB΋D$$D$kt$>!ɉ1T$ UCTŋC&Ph"h Y FQ)+9s~d=P QRL$Qƒ%uI%uUMFBU9su}\$$9\$tRh)h YT$R* [^_]jL$,Qj&T$0R'UWVS l$ D$t |$,W]D$ D$@PSNjt$ tzT$ tpZts1;\$}M CDF;\$}?D$ ͋1tPPRPPhFh YR@$(Pn뷋wv [^_]Ë/QQPRRh@h YPǓ@$F(P%EGB [^_]Í'UWVS )Ņ1 t&GDu W1RQD$9}T T$F9}J\L$1ۅtPPRPPhch YR@$'PoËD$밋t$l$L$ }}i [^_]ËD$ @ 1[^_]Ív'UWVS t0Dž(1Fu V1RQ9|!ut$ n [^_]ÐQQ RPPhh YQ)@$&P臗UC9|렋D$ @ [^_]Í&WVSt$脵 jxPÉ8@<$Z^C 1[^_ UWVS1~P,P-~1ɉD$9}G~01ҋDtGA9|l$\$ 1}k [^_]Ël$\$ T$1}k 2  [^_]ÍUWVS1~1PO5~D$9}N ~81ҋD tD t EC9|t$\$ 1ns [^_]Ët$\$ T$1ns :  [^_] UWVS1~1PN5~D$9}N ~81ҋD tD u EC9|t$\$ 1ns [^_]Ët$\$ T$1ns :  [^_] UWVS D*Dž1Fu ^S N1ۃ9|!ut$ 1n [^_]Ít&PPRPPhh Y P@$#PwUC9|렋D$ @ 1[^_]Ív'UWVS 'Dž1t&Fu V1RJM9|!\$ u1k [^_]Ít&PP RPPhh YQY@$"P跓UC9|렋D$ @ 1[^_]Ív'VSt$jL)|1҉uSS^01Z[^à PW‰^SS01Z[^Ít&UWVS Յ҉D$D$ P5LNjKtPt L$9H uPPBPPPhh YrVB@$!P蠒ƉtBƒ tC t> t9Au;dD$W\$1{ [^_]Ê&ttO4AO:t&D$t&D$1t&D$WrVS|$1ۅ Cݠru SK1҃9}+ՠrB9|Vw 1[^_ËVw1 [^_ÍVSt$jJ`v$`vU^C1[^Í&UWVS 4%Dž1t&Fu V1R:J9|!\$ u1k [^_]Ít&PP RPPhh YQI@$P觐UC9|렋D$ @ 1[^_]Ív'VSt$jI $T^C1 [^Ív'VSt$j`I$S^C1 [^Ív'UWVS,Ëרu-ufub SS S1 uN,[^_]Ëst&0vSPhh YVCtS1t jEUHs<$D$8t$4,D$(8D$ x\$$1D$k\$(T$ ҋ;\$$T$D$T$ @D$1T$F9΋D$\$(l$CtVhh YL$$QD$(,[^_]QL$$QD$ PRlju-D$L$@D$L$ 1|$T$ \$F9tT$$L$8uD$ x P蚈D$ PPRUUhh YRs@$Pэ|$$L$(o9PPRPPhh Y,U4@$P蒍|$$\$(o;/\$$1D$ D$kKt$(>Phh YR PQu&VSQt$\$u,u@tT D1҅u#QQRSУQQVR&[^Ë0Rhh YPuPPSPPhh YS@$P|땉UWVS ՋxD$Dx@ǀH| @L P@ P D$ [^_]ø\zEÅPPSjI$D$EHzÅPPSD$PH$D$qE4zÅrPPST$R}H$D$1EV zÅ>VVPL$Q=H$D$D@"yDÅ RRPt$VG$D$DǀyÅPPSD$PG$D$qD긼yÅPPST$R}G$D$1D긔yÅnPPSL$Q=G$D$C R글yDÅ:QQPt$VF$D$C@XyÅPPSD$PF$D$qCDyÅPPST$R}F$D$1C0yÅPPSL$Q=F$D$ByDÅjVVPt$VE$D$BNxÅ6RRPD$PE$D$qBxÅPPST$R}E$D$1B xÅPPSL$Q=E$D$A긤xDÅPPSt$VD$D$A~QQh UƉ$XZSD$PD4$D$J$fA?&QQhp4 UcƉ$XZST$RjD4$D$J$A@&QQh UƉ$9XZSL$QD4$D$^J$@&QQh UƉ$XZSD$PC4$D$J$v@s&QQhP UsƉ$XZST$RzC4$D$I$&@ / (UGƉ$M]XS|$W.C4$D$rI$?D$ [^_]Ít&'UWVS$֋|$@PhY…1ۈÅt iij l$URV#ZYPh"Yht XXtt[^_]à h-Y0tgPuItLWWT$8RP_6HHj Ut$<WV #ZYPh8Y[^_]ÃP믃 P73릃 h-YUWVS׋t$,PH]ZjPJŅt F h=rHY[jPIÉE<$[H_ZjPIǺt%L$$I~t&Bt9t@u1 h= HZYjPI[^_]à P\w P\ZYjPVI[^_]Ív'UWVS$D$@;T$PZ \$4l$\PjSD$4P)D$< ^_T$XB SL$4QT$hZ|$\D$w VzǍpl$]tCK 8xx PTzt0vuFUh:h YP^Y^l$XD$U RPt$7 w|$/t&M u=P Jlj$yD$ D09|#@9}hCh YST$ RD$PPWT$ REL$ ΅t D$ FPhHh YW$mfl$D5PPjUs4]Ƌ|$W& hPh Y\$ S$YC:$"Y7:$-Y+:$8Y:tt>QhUh YV1ۅ:PPS|$ .€ %t'\C € %uRSUV膨OŋWA9}m,BW< u t&C< t݄uPhnh YVH \$PC | C dQPPRW{4W| Pw>CC0PrPL$$QD$$PRuu l$1E|$t$L$?sL$8uD$ xD$ x PtD$ j.3$dK NN>PPRWWhJh YRTt@$PyL$$9PPRWWhJh Y>Wt@$P{yT$$:Uhh YP Q PQ(PPPShPY d1:\$$;v'WVS|$\$ Wlte P,ƅt@ \$(SL$(QT$(RWVV1t3Whdh YS[^_ÉPPj/Wut @Put1[^_Ðj5htYj(O@@@ @@@@@ @$ÍSQQ\$HuRC uOCubCusCCC C$QjUhtYSXZ[RjMhtYPCtQjNhtYPCtRjOhtYPC|QjPhtYPnCkRjQhtYPRC Zt&QjRhtYP2C$Et&RjShtYP+v'VSPPt$j_htYj(VËPV FC1ulVC 1VC1VC1VC1 V C13C F$1҅\S$[[^ÍvPPRPPjehtYRp@$PuVC 1mPPRPPjfhtYR_p@$PuVC1FQQRPPjghtYR&p@$PuVC1PPRPPjhhtYRo@$nPMuVC1PPRPPjihtYRo@$5PuV C1PPRQQjjhtYRo@$Pt1҉C F$RRPVVjkhtYPFo@$PtƒS$[[^Í&' t à j F Ív'1tB[t&' u RRh@M P# Í u Í Pǩ ÍSPPuY[[PjRD$PLÃ1tCu3PhhtYSR hhtYSY[[à Pn뿉'WVSt$|$tt BSjQW菦Ã@t Ps[^_RRWPPhhtYWnm@$PrsC[^_É j 膡uPPWhY|ZWt& 1ɋtPjRD$P1ɅtHȃ ÐSPP\$ … Шu tAuXZ[PPSQKXZ[ÐVSt$V1ÅtZ[^Ét/ jl )PVhY[؃Z[^à jVlB밍&VSQD$t$tQRRVPȳÅtZ[^át; jk )PVhYJ[؃Z[^Ð VW뭃 jkB뤍t&D$tcv UWVS|$$l$(t$,VUW腱Åt [^_]Ét4 jEk)Љ$WVUhZZ [^_]à jk A 뫉UWVS D$ |$$l$(t$,tYVUWP Åt [^_]át? jj)Љ$WVUh\ZY [^_]PVUW蓰륃 joj A 렋T$t飰vÐVSP\$1R auzPPh]FSu(uduP Q%t-S Pu׋C FRxuӅZ%[^ Z[^1Z[^Ð&UWVS @ҋt$ %1ۉpUUhVuڋ-( Ȩ51bD$1\$KT$$te NQ8 PRhj hh SRX$S]e4$L$F4$$4uPjgh D$P1D$]31ۊ<=C €=%utq=ulPPjV!\QQVh \$mC\$vz|$% [^_] [^_]à VgÅte pV7u:PVRhh hh VX $Qdmk h h봃 V9RRSVRm7 FP7$ Uh SQhDh hh SyZ$Rc4$L$F4$$4u"UWVSDt$0 11D$D$D$D$ D$D$E h SXZjh$6vPPh) VtYP(w$ GD$ h bD$([^_]Ë$PPh) VMuߋ5(<!À11݋T$%f݋|$ %z݋|$ %݋|$t&N Rr6ul$ |$ W`p L$^V@D$E=|$ 3+ -T$ˀvH UhDžnVD$ W= L$QIaZS` Pt$Vh= ED$( j{ jY jG j j) jw PjD$PGWWt$ VhQ A D$P>Dž)ZYPW1D$ T$R PQŅPP|$Whe cU1t~QL| u"9PDGPh {c8Tũ U+1D$ \$ SoD$(6Dtȃ h~`붋ERRL$Qh sD$UUT$Rh QD$PPD$Ph bPPUh  D$(qVSPt$u0@t1Z[^à h  tPPjVfӅ~ 9|9s1 |wSSh F0VrZ[^Ív'VSPt$u0@t1Z[^à h 3 tPPjVӅ~ 9|9s1 |wSSh F0VZ[^ÐVS\$SuFf1ҋ(t9C 0V …t 5\L$Y[^ V'Z[^ÐUWVSl$,h [t @- 1h ;0@& ph +@!XSC VF WG PPT$RMPUT$Rl$US \$ŃD$PSV Ët$L$QVW… ШuUtQSQUh _1B xh   1h  [^_]Ëu >W0 PjjS; jjV, tPۉtPhc^1롸  WVSӅ =th+RYXVh+sutt @VVPh+Au tt@uZt;tPjvh Sp1[^_Í&PPjRW h(@t&RtFPjh , tPVjh  t5=7=볍SRRd\$:PPh St1LPPPh S|uϋ ˅…%t$ h<útM SY;tPhbh S $SW[ $Q:V1҅uQZY[Ívl ZY[à h<Ë .PPjQxXZQWZYPh z X$ReYZY[Phh Q.UWVS ׋ D$9PPRD$PÅtyPPjSO1ƅt8uoUhh P@ޅÅtktgWt $t 1[^_]ÍPPjS 녍t&Phh SO@Åuv D$uP5Yu<uj h(^tg [^_]1tg [^_]à h /Rhh PRhh P뀐t& VpV l$Ë8UoXuBu[ h(tSShh P;1Qhh V؃ [^_]Whh P돃 V=볍t&'UWVS\\$0t jb [^_]Ë5d&PPh Sst,LPPPh SLuԋ=\h(҉L$S8-u x) Q9{T$D$tcl$l$D$L[^_]Í1T[^_]Ë-cD$D$SD$D$t~ D$ PV |@hGh WZYPËT$ R#'t6t WTPUh$h WS_0VPS Pl$Uh! h ŅSD$\$Z;%D$ Wj|$WS1 hh SL#Phh W'PPL$ QUÅu@%} jPhh S1 h+4D$$D$ h  \$ SÅ#Z Sk L$ QS hXD$$D$U h Cil$ tut PRPhh W 5@%51Í'ÐSSS\$t%PPSh 8 hh S[D$ ZY[UWVS 11\$ PPh* SOt2pVPPh* S"u΋-(1t}}1 m߅t1PPVUPÅuE ߋQmuυ% [^_]ÐvuE:Q [^_]Åt5\? h. uh ' ËpU1K0FK{G S 0^_Shi$1$.  [^_]à h Yt*SSPQQhh PR@$PsWRRPh h  jjj5Pƅt{~Phh WP VPjPPPtqPh Phh W; hPhh j,@  ǃ뇸=눐 =R(Ph`9RMdt9\t8uML$RQD$ (PQlPZ(YRj QÃ] (Ph<QKMRP(h`9P4M뜍& \t8u/ XP(APh?RLX (QMÉRP(hl PL뺉' L$u à hL$& (PPh=L$Q1@t:\u7XP (BPh?QRLX(RuLЃ À8tRP(hl P L뭍vD$Ph>Ív'D$Phx Ív'D$Ph Ív'D$Ph Ív'D$Ph Ív'T$Rh+Ív'L$Qh ~Ív'D$Phh^Ív'D$Ph>Ív'D$Ph9Ív' T$D$tQt,PRh Åt-D$D$  t&2PRh ø2̍t&D$Ph Ív' D$tRRPh xÍt&D$  ` D$tQQPhHÍt&D$  0D$PhÍv' L$QjjD$Pz\Í&'tÁ=` táWVS\$|$Gt=PPKRPPh:h-CQL@$PQ F ?… Шt tRh4h-P z… Шu!t=t4[^_à 5VR$*뾁=` t[^_Ë [^ _ÍÍv'Ðt&SSS\$$D$tPCuTtECtQQD$PRu"CRRQhx  T$t=Lu"$T$Y[[Ë8-uxux-u땃 hL jv'SSS\$teCuCtZCtQQD$PRuMCtSRRPhx gZY[Ë8-uxux-u릍t&ZY[Í&u1$ZY[ø6릃 hL $1VSL$ 11ۊB<w"FA\ЁB<vtt[^Ã[^Í' dtujuQQjjTMt` PPRPPhh-QwI@$PN ÍRhh-P뀃FZRgF s$QT$$t D$$8u 5 P(hPE 1 SQQ\$u1PPSPPhh-SH@$2PN[Rhh-P>빉'UWVSD$l$,|$0U[H5ND$&Ntt x ut&Xtt&T$4D$0|D$0T$4w @CVVRhhD$$tfWWL$8QS*Uu=@t = tUUPkuV7tRRPhFuD$$<[^_]à D$t$k9~11XtB [^_]ËT$\tۋDuӨtϋt$7ȍvUWVS 1=~O9o ~T$ L$D$ {9LD=T$0D$ [4 )‰uPPT$(RQ=t$k9~11XtB [^_]ËD$\tDuԋ|$>͐&UWVS 15~N9o ~D$ L$T$ s9LD5T$8D$ [< )‰uPPT$(RQ=t2k9~1Xt@t @ [^_]Ð 1[^_]ËT$\t͋DuŨtt$7뺐t&SPPL$D$)‰u PPQS<ZY[Ðt& ~~h{ jRP\@UWVS,É1D$D$ $D$(D$$&PPhSctPT$(=$+tT$$F2$x&l$El$  PPhSu(O1 PPT$$RCQ}t݋k F}Ws,[^_]Í$t&t  vFt&PPCRWWhhK1Vi>@$PCZYjPŅD$=t tt$D$D$D$PPj[Wl9D$ tD$D$  W D$$ D$ @ W迲D$$T$D$$ W_ƅ9Pt D$(D$$ ‰Vl$(!VPhThW\$ <$D$$D$dL$D$pt D$( @ L$ uD$$uttL$9(D$D$(MD$ uD$$tD$$L$ ‹t$QD$(!…Q…%D$t$…t$*D$$tL$AJ Wf h Wl$0El$0 houWt$ Ft$ VhvO%,[^_]à WUUWh1-t$Ft$ h5 W뛋4$F4$PPWhT$BT$ h;D$$  j q 5$V71 W[l$El$ hljl$(GL$ZH P8+PPl$UQ_c t$ VD$$L$D$$q W*D$$3T$$ T$ 9 WD$$ L$[PPT$RWl$(D$$EQ\$ SPj,zRRj)Q5D$ 1VT$BVQQPPPhhJQP9@$P>PPVT$ P肯l$$HUh ʅ~ PUhhVt$N N$@$PhD$PjjWvƅt ,CUɛ<uShhV. h4< h(hW NPPT$Rl$ U蛾?RjFPWv: PPhhj P袥t/HQhU6Vh>9PPh=W R 68 D$t hXCÍv'D$1UUWVS - |$ $W8-D$pxt|t&D3RRPhDF2t \$C|3uۊtHL$<u>‰D$Vt&D$eoPEu1BD$uڋ?] $SF5vD$D$( D$Pt$Vj_: ztztVR6ZY&P Q ƅD$QQ $CQP_9D$HD$݅ŁPhhHVN?t$ $SF2Y $Q01҅ [^_]Ãn$BBvW2$1PPVhz6ŁH&t$?UtPP$Pj W8W,$/WW=$Wj 48 $R]3 [^_]ÐUWVS,1ۋt$@D$(WWhSVt9aw$,[^_]WWhSVͿ uǡ(5\D$t  L$t  t1 ~91 F9~ltTuttt tDuRRRh[4 ~떐-nL$y\$RRjSƅ @1ۋ-~x9}$ ~99%JuK=~)|mVhhiW؍AŅt [5~~<[)ڡ~ R󥡤~=~tRhhiP~-~K1~HL$)l$ h zD$(,[^_]Éҍz D$ tD$ D$D$$SSjU6D$ T$\$ 1@uRh5hiP|$D$D$D$|PhLhiVCD$ tL$ CKVVjW…GD$@D$32{zKJC B sr{z|$$\$$D$$ p>W0 ÍPh?hiRY^WP5XZ_strDuctVL$,Q,Å G1PUVh hHhiVcD$(PPD$Phv jRl$ l$>T$cSh|hil$$UV1D$(T$L$BT$Wt̅u-\tPtmP됋P t$~QD$8덃 T$ RtUU Qh^ W14-~ j2Ph^hiD$$P$Xt$,V1D$(~l$ ~WhhTmhiSá~ @5~1=~T$ F<@QTQTQ T QTQT;t$|tm~=~DDtVhuhiP@~-~\w. Pt$Vh^\. PUhL$Q3u'f1ҡ(tRjhP=$‰Ѓ ÐUWVSXD$4T$0h Ԙt @jD$ h 讘i@_PT$ h 腘`@VHL$ h4\W@MX\$ h43N@Dpt$SSj|$4W-ŅED$0RPUj&1@-D$j D$$uD$`D$@%=@uD$$K1ۋ|$\D$\T$`11 u G9UWW|$0WhLT$(l$$L[^_]Ë@D$ h ED$ h %D$ h4D$ h4D$SSj|$4W,ŅD$$t c(8t l$4UD$$D$$u2(8%HL[^_]Ív=PPL$0QhbPPT$0Rh ShhyP袾D$, WPU+/NjD$,8'Ë0,$`&3D$$@t$PPP~PP|$(WeD$$# hҎY[jh$XZhhD$$PPjhD$$t hWD$,P jBAt$ VB6ZYSPt Pjl$Ur hhyW蟾 hrjT$ RKD$$D$$ uD$ WWjh'D$$oD$$t $<=h5HNPhh5$U_Pjj|$,WPPjjT$(RPWjjL$0QPD$$D$$qgPhhyT$(RpD$$%=VT$$RL$0QD$(PFPh$Ph4^D$$ h$<jjt$ VP Rjjl$$UP. h譌Pt$,Vj\$Sf l$2D$21D$3Uj|$WHPhhyt$(Vk_]\$0ShT$(l$$~$ j~PPjhhQhhyL$(Qt&'VS jT$RƺD$t $PhhyV豻؃[^É'D$SPP|$ɡ@0Ʌt duD$x{ZY[Ð u h'Ív HP&v hÍ'UWVS$$h^XZjh谎]Xhh蟎Y^jhP葎XZjh胎DPPjhHxgdPPjh趉t  @VY-PB-Pt1uhkDŽ$$DŽ$PP$SWW=?r DŽ$PPjh##ƅt5DŽ$~jVjh`O<du=y-t$$K j /$脈Y[WhGXZ$Ph3t=\ Wjjj$U"N$ $Q+<$p/$4$t hNDŽ$ h3=t$$Ĭ[^_]Í&$`DŽ$DŽ$oDŽ$ tQ*tAUUjh$^ d]RRPhp諆PPjhh%UUWhP 耆 h "==\0`#-}$;$B $A$Xk$MQ $QB $Xk } $QZ { $dh艕DŽ$;$9$U $AX $B$$Jh@J]@] V̔-@t=d KQt@҉D$ t=d--D$ tPPPj\$S-!ŅxNPT$RjU hUhD$P,$PPjSt L$QA hOhT$R蚴ϐUWVS 11\$ D$D$PPhS_t/cpa=PPhS0uу -(U$1t \tH j [^_]ÃluaD$T{ [^_]jjjSBD$ZP5y$* UÅt $9)tPhhUS݅PhhT$ P/SjShW^$۱ZYp-WV"؋<$D$1ۅdt5`t=`VSL$QU2D$\$k UZbZP PUhD$~tPhhU?-`uhu15`u' |$W" l$ ]Snr$t L$ Q[a j1LD$ UJ ^ $9SjShW$_ZYp-WV6! hhT$ PeL$gPPWVVhhW@$ P 3 j^U jB* J |$ 7VD$ lt@Ht Ð`uPPjh ÐW lVS|$hu3=… Шuo j= t=P t= t1ҋ59}vtx tpB9|늃 h[^_Ív A Iu=`sVVjh] WË l@(Sjjh V  vVSVht$tl9QQ(PSY (Q(htD= t8=P t1= t*1ҋ9} t x B9|=… Шu[5lu jۍAW A Iuա`uPPjhi빍t& V뛋(Sjjh   [^ÐUWVS ŋ 1ֿ@u0)؅XtaED$ <-t\t 0 vV UDžxt,T$ :tKy [^_]ÐRWPUu؃ [^_]ÃUjj jRDž|t֋-)9~ȍt!븍UWVS11\$0D$D$ D$t؉(t#H:-%PPjRGuxWWhGS賢tcew$W[^_]þt&D$D$名t&D$ ֍-ȋ=(t }-1_RRj=3VXQhhOj XZW QPPhhOGR@$萪PoFXZSQQhhOS@$fPEFt.?N3x13@ u0)Ѕp}Gڋ:D$xڋ NjT$ p;|$}D$|$D$t$  $L$D$ut$T$'9q T$D$ t%P A҃*RhXL$QjP Qh?D$PQT$N9~|$ 1 t$VbQhjhOUfZËT$$RYL $ըËD$(PUh\SjhxS D$$P hvhOt$$V賩[^_];t$D YD$*T$ t%P A҃*RhXL$Q=RRh?L$Q$D$N;t$}t Eu1tO$tK$…x7PP PPPhhO4>W @$舧Pg$$uH5(USh?Vot ;VjhxSi}+PPSPPh/hOS@$PjSRKQVTE h2hOVuShhO\$ SߧKuUWVS(ƉՍ$S=XZjSs_|$W( WSj4$,…x;|;t tVP/PjWj,[^_]Ðt@tQu,vp\$ 5,vQQURrÅxRjWjR,[^_]Åul$ -,v끍JSSQhMi& (vD$u j蕿Ѓ Í& P7uf1ҡ( t&'SQQ(vD$u j5[Z[Í& P׼uދ (ʅtt …tu1ۅt B8&tۉY[[xuᐐT$BQBPh; 1 L$APQPhC 1 UWVS$v\$0u hZ迺[^_]D$111D$t&PPhkSctUdw$[^_]ÿÍv빋T$뭽릍D$떋(1҅uz%D$ VO s Q=ƅtPS QVhC! tgXt`2PP u 5PVF1 hrwPPKPhu G=\UUWhy 1CCD$ RԺl$%5\|$…%t,WWj/L$ Q)t \$ S-1CT$ҋ0tQ |$ WOt) j Pl$Uh!;jjL$QV ; Vu؋T$t VZ:D$ Vsu V^u VZDžt P\N V船D$ tPhhWXt$ 6 $SFr9D h V jPWV:qUWVS\\$pD$8sD$PPhS蒓uڡ(D$ |$w.Ut;D$? h[^h| T$R4$q\$D$D$==~L$q.l$ U5ۉD$A1P=~t= t8/c&1ۅt$F\=t$=PT$RSD$(Pqt&=P QSt$(VH~W|WSh\$?=~lǵ\[^_]PPCRhtPPCRhu뫉+{<=~\=L$)l$\$T$RD$ P|$$Wh4脴\[^_]ËVWWjPWÃt?P>WjS$=~s hF[Sm PQh뱃 5$V1Z 1j $FT$;~l$ D$ 1 ~Lۃ \$ Sj"D$LQ\$-SXZD$KUhux!‰%t u˃)"$PPRj C"~\$ F\$ ;5~8u#1\[^_]à j Ty j ;1ΐUWVS1ۋt$0ޒPPhVQt9aw$l[^_]PPhVuljً5(ƒ%t`t[ hH뤍t&jb ZRˀ=D@:2@ 0u~{=tq-Dxtg e1҅Bu ZR]etZ S it Peed9 V^|ZYjP" hshV迗1 1r01t$ QQVCR{PP$PT$ Rv] $XQj D$tRhhP"ÀOitSSjV贵ljՅcƅ1@ux9|91ۃ h3 oNj-t?uA1 Qt8u=P݋JՃC*PUh  띃 RcD$f ??" 돉)Pdh1cPPk}Wh $S|u!n}1FPT{%,VVt$VW϶t>-L$ T$9'|9w!؉9|v9nVVh4W atk81҅B,u z Q bt@ Wet P{ba9 R aJ D$PPWhh 1E R`Y WŃ W贑 W臌߃" h4jl_5,_,PjRW_3`=,))5 Ɖ5 1|$ )Wdt PMa_9 R_UWVS11틜$0D$D$ 覌PPhStMl w$跬[^_]Í&D$ !PPhSLjFu=(KN:%tY6ꍶfVD$ CvD$ 3vD$ # VzŅx;}tShhVSXZ^ iRU蛠61 hPax ËpW_]KF CK@ {/ /Sh`$M$k$as$\$ VqY]jV$_ SVj#<$ctt,uAW PlL$AL$RjSj?ut$%tPjl$Uj( hƩt;~#t1 |$WyE1}uރ T$RB \$SCэ&UWVS11틴$0$蟉PPhVt2hq[anPPhVu΋=(D$ Wt,5ͅ% u; }  twP׫D$ jL$QjF? $UQ]Xj$V^\$S5 L$Q$Rj.SSL$QGRYl$D$T$ 11 RRjUrur$e?[^_]Ë$t4 Q jL$QjFD$[^_]PPjQj. $t Uj1댃 Ui1yUWVS,$@@1D$ D$D$D$yGuA<-…%AL$PPS|$FW`>mD$$U <-uyuylyuystZyuyntNyuy-ywy?m¦1lu警,[^_]Ë}>oED$80PPSD$P=/D$$C\$ L|$tt&U:<-q À%%?L $P\XZj$SXL$,Q@ |$$W$Vj,$9…x ;}5&t} R-PjL$(Qjml$%,[^_]ËL$ mAL$ vQQD$ P QtpD$T$ƉD$D$11 uQ|$Pj|$WD$P,"|$G|$[vG Q迦?U À%%~SSQh`ޣ@tcXWjT$(Rj jt$VS!,u PQPShDu@XVVjU>,[^_]D$x_/nPjL$QD$ t$V詥t! Pbt#WPT$ RhDh \$SeOָOQPS=m Q[됐VSP\$tUCu2tHPPVSP $tIu Z%[^Ë8-uǀxux-u뷐t& h|:3Z[^øZ[^ÐUWVS,D$@D$D$D$D$=T$@J8-8-8-8-8-<+<- ШWWt$(VC\$SЩ|$@G;+\$$t L$ t$B|$ ݉T$…%Ņtul$1l$ËD$@L$@D$1;}(=PhhCR襇;|,1[^_]Í=|$ 1ȉ1 uu1t$jt&l$ۉl$x$9| 9r\$ȅAD$ )6-xfxl\D$D$ t&xIxc?D$D$x0xv&L$L$xxp l$l$t&xx-<+<- Ш S{,[^_]ËT$t+p9hJ%+ hF$fÅID$PD$Pjh{ hhS谅l$HD$ L$$\$IPT$$-D P)Qh D$ L$$D$ L$$xW|$Ul$$PUD$uM<Ph1D$ L$$D$ L$$y-$SSUj Z$S1x h輝,[^_]WW5T$,@oWWD$ t)Ph뒋5PPmaw $vې[^_]PP=\$pSWxut$l\$he|$h1؉1 L|$( |$4Ws]]S Pl$0Uh$褏a&PP=L$pQWݗt$l\$h1ҋD$h11 t$hD$,t$$D$0D$<D$QQ D$pPQ^t$l\$h{|$h1؉1 b|$4VD$8I `7T$(5(T$,t$t|$$:;D$uD$=PhhD$dpjpsD$ll$,n hD]|$4WD$Tl$u\$8uD$0t L$DuD$D$0D$8T$8|$t l$8I T$$D$PD$LL$4 T$8,t$4~PPjh%H|$D=`< tl1ۋ-Å} axhpl=p5t@h@l ؋Lh lDP UxUjh CRR1t$dVhP CL$4Bɉ1D$H\$8!D$tD$L$ <T$\$5 dSldƃ1t3 VDÍPhhRVCr ` DD$D$ L$ t$ A\$L$ D$g\$T;\$Xt$PT$g L$TD$\AL$T\$8D$PPjT$oR|$4W辁DžD$HD$\L$T\$$"t$4L$8D$4~ =` t:_p1ɈXh1ۊ xh5tȉplx=l| Jh.A|$HD$L$t$\$L D$hP'kXZUhGYQ h$hUq~ ~h*hT$hRpD$=` C|$@<2L$gt$<\…ÁtT$LL$TD$\BD$PT$LAL$ThhD$`耉D$`PT$hRoD$l@Y[L$dQhP ?PPt$oVD$4PI: `À بtT$Lt$TL$\BT$LFt$TL$T\$\T$gAD$4L$TGt$49;\$TK\$TA舾jVhhPoD$ #=15PPVhD腈VVShpm -UɊ\$D`螀D$0}QQjhc 4D$DS讀I|$pRWt$0Vj_$\$$4WWjh! hq>t$\t$ 0D$8t/ €  Шu u1Ȁt Cl$uȋD$\$\bH 1Vc|$\?SD$dPT$$Rl$hUvXDžtL$`\$L VAPPWVMNÅtUh_hWm V_Sl$S}|$76 1VҐuGPPh=돃 V蹐& V蕈 hBh\$,SmPPh=VgEPPt$VhP 1<6jjjj1ۃx \$@8u\$@t& hE‰D$ptPP\$pSRt t$l\$hx1ҋD$h11 D$$3 t$ V脎 l$ U茇 hh\$hSl l$4U|S\QQRjH$GPPW L$YPu l$}7VWl$PU|$$Wt$hVXÉD$lL$L PFeXT$BSĎ#PPVSK hhVk D$huVt SSQhh|$,W=` ll$0B|} Pd4$%YPPUV1K hThU|j=` fD$0cPPL$dQhGYJ3 (PPQD$$P[^(S>D$$^PPjD$ P賊ƃ VRUp j|$$WL$hQOÅt Pd]XSVV$Wh {yL$ y7VuTPPSVJRj]8W Pl$0UhfPPUV訕{UUSV萕PPVS}Phb \$CR[ hrVVh jEY[j\h  8ZD$0P*7t$ht$$L$Qu h脁PPjheVSS t$t_1ۈD$t&tCT$:uRRPVuՋu+uZ[^Ðt&Z[^Ét$[[^ PtZ[^Ðt&WVS t$ |$$10D$ tA9t=t`tD$ P5t}tt9uƍvu-QtUԇPRhu[^_ÃQRɃ-Qhύt& RЃRЇ멋둍D$ z&Sjՙá1ɃtAu[Z[Ít&|$-hZ4译t#PPhHh3F$3V1à h3s$371Ð |$-%@u hR :$R ޗ1PPh1HhR GF$R 軗1Ðt& D$|$-td=@t8vtD)Ѓ Ív8euhuDD )Ë ,PPhLQ#RRPh3QMhuDD )ލvD$8etD1u @uË D1u=@uÍ |$-tAHx)Ѓ K u|ٍv'WVS |$ t$$tx1ۈD$ taT$:uRRPVuՋu"uI-Á1҉(RRWP1@u V[^_QQVWЃ1'UWVS,111Ct&ujEt Q|84FtH4t P*tԋ(t΃ QV벃 RЃ뎍wRhhVa11Ņt[1FtC<4tT=PPFPR^ Q (:xu D=1h8txXPPUhB=ËHH…%t tKShhUa<[^_]Ít&UWVS l$ D$|$PPWU蠋ƅvtg1ۈD$ tPT$:uQQPV0uՋuu\RRj-P@u V|PhhV2aPPWUƅY [^_]RRVj-&UWVS l$ tL [^_]Ít& h#7tۋPtЃuWWpVSSh"hHQ@$h_PGDžtD$l$SSUWAƅ1ۈD$ toT$:uQQPVuՋu0udPhhV_mRRj-P @u׍& V{Qh&hW_RRVj-Ѓ띍'HxÍt&'UWVS,t$@XPPh@uVKUt'?ux= ?%H%,[^_]D$D$ ^ <--ƒ+ Шy<$Y?oJ9D$<-<+օ1T$:uRRPWuыS-PPUS&@hD$$C$$6+SSÁSj^Åt P+ hhS]@t 1,[^_]_Åt P+ hhSI]1ʊQt-=y36-PPj+jxB_]j+jv7D$l$  ȨuUt$b71XRRUP@ Wx ,[^_]Zv1PPjV z뜉\$L$D$ T$Rw#v-QQWUЃWD$ :UWVS 11\$ D$Ut&PPhSRt,f vwPPhSQuԅ5(…%ND$@t S} S0…%t A APu9PSh5t\$6C\$Wt$% [^_]ÿ SV~BPPj[Si@$D$ S|& SvxRRSh/f S0-t [^_]ËD$…%tAu\PPSh@t@ SU@…%ttft6U S܁6B SYPPT$RQ~uL$AL$롃 h\r [^_]à ST댐UWVS 1ۋl$$|$ t$(t @:WtfCtiCtrC€ttCtxCt;@-t @PPۍD$u-PhO%t-@'xG u=PS PPh hdhVMX 1[^_]û$aWf Q붍vUUjWz맍t&toPT$\RSht&FjOQR^P]%<$fA$aY \PPQh$jWRSPt&'jD$P,t:@u4QT$1R t.@ t&QPo1 Í Í&Ӊ'UWVS \$(|$ l$$tN W-Ãt4D$(S!ЉCtut-tE-t [^_]à Waƅ@@PhhjTPPWS6ËF%KS KF tFS SF FPhhWUC /PPjWV+ÅtLxH HQQPRRhhPÿ@$BTP!9PPjW5Ëppt&UWVS,EEEEE]NVVhSJt4faEVVhSJű=(E t t]t E tQGUҋE P)…M2E r Ɖr?uuu-M%e[^_]Ãnt'pme[^_]EEPPjURwƅtE0 ]Svtt]3=E EhXZWSUE܉$jU؃]$ hhMQPS]3QEPU RuVd?M X!ˉX MQ{nt uFuUBU MQpiU뇋M M 2PP]ShkuFuV}  }tT} tM M SE t]C]} t U U 1ۅt;}u~E Bt$P}1W= tl=@ teQRCuQhhVRE t$PE1P= t)=@ t"QRDCtBtƹ딹׉jjD$P_Ít&'jjD$P?ÐUWVS|$(jWpÉփ1 ?9߉|U($uv$ B~D|w1 [^_]ÅVVhtGPl [^_]RjOhPPt|9Mdt1QQhtwPml [^_]VVKRRRjWhC0Vy@$NP׿ D$. u nnu*oHu dnt&t SnvKrԉ'WVS D$PiuJ5(!\u<܇؇uLPP^ QhRh[^_Ít&^WWj/ Q蹴t 3VkPPNRSShhF8W!@$MPǃ hr5XZWhP Fm jALQQ%PWܒ$rN*&F 8W" Dž hrXZWhP ksylQQjh KXZjRokHD Qp1 jA6)PQQPRRhhPϷ@$NLP-YXShP XZSh@ $A  h Xff|Pj*ÍVSSt$1rFfuWCQQhfFVBu(v(tju< Pflt' h$eZ[^OfZ[^PPh jh)[ Dv^|jQ1ă hAh뭐VSPT$t:PPD$PR8i^XSL$ QC hhPSLZ[^á\8[t Z[^Àxu hLd̐VS$PePP\$XSjղY^t$VjDzXZ$SRfX$ZPj 9[X$L$`QS~fXZ$Rj [X$VP`f5$XZVj ^X$L$QS=fZ$YRj ո1ҁĤ[^ÐUWVSŋD$t P"D$ UrÊD$'~ @…%<-tPPjV@tyuut4QQj{Quދk uV:dũ [^_]SSjjgl [^_]À~wDžt.vPPjWSÃt@tV~'t?uՋD$ [^_]à P?uQQVPG QycD$σ Psw$<-e~[Q VhnPPjVZ@Zf h>PPjS/$JPPjj$htPPh3 j$PPh2 jUWVS t$$l$ D$D$ u & `^  U9of  UÅt\U8L$D$AL$PhhSFD$R UmE+D$ U7SD$` UwÅ D$S [^_]à U ÅiPhVhSD [^_]Ð U@MD$t hu hج UOueDPD$PjUq htuRPUhp hKQUUhF PR} PUh hhSQC S U׫PPUhծPPUh4 jKQU虯$ P萫SSUhF莮 hiQ UXf htFYPPUS80 St{PjSj.^t& U ht UԪR@PUh]ϭRSUh躭PhphS1AD$*vUWVS<1T$Pl$PD$8D$4U8-t5;PPhtl$\U7cP$$T$,K-p-a-vmtML$,1>-zL$,1NL$0^tuο9uT$,Ct}CZ<[^_]t$0ztt$0U\$,@p뭍t&t$0t݀a8L$01Al*T$,@ad|$8|$8\$8\$8PPhtl$\U$6(2PP|$@WSPƅu D$8D$4D$4uʃ 5$V\$4%<[^_]ÉT$8T$8L$8L$8t&D$8@D$8l$8l$8t$80t$81Al1At$0k MQ6Z4WVS0֋|$@~b't ܦ0[^_É t~uڸ1҉WV1҃0[^_Í&PP\$(SR軧xًD$ T$$VL$(t$,w蠦lLkQQT$RjgxRRL$QjOi\$T$L$$  Ӊ^\$T$ t$D$  Ӊ7_&UWVSLËl$ht$`|$dtCu~RPhl$ UH U,Rh!Au h\[^_]U,jSSRPWVRP]\[^_]ËQRh뀍v'UWVS11$=u?aSH~A;5SShVc2ÃtgS?H 9ȉTYSShV1Ãu(51ۅl$h"D$hT$lRPCW UT$p~SQjuD$pT$t뷃a-G& h=hRQ: 19 =L$8D$81ҋ ~9B8UU,UhSČ[^_]Ph"hhV94TČ[^_]Ë ftz1\194D$49T$45D$4Jl$H| ‰|$L\$Lօۋ1ۈ1~9 @:D$B< wQQT$RW%R7l$D$T$ 11  U땋ꀋ$ ,[^_]à $RcXZj$Q蒚Xt$VG V$Pj]l$UASÅx;|@t t$FSILQjT$Rj迚|$L$-|tRjl$Uj苚${/$1҉ Ё,[^_]à W*K$,=D$ÍUWVS<\$P(PPh=S$@PP(T$$RPKD$$D$t$l$~^\$p?:L$3- 1ۅtC  4 u h *$ Wh S!ŋ|$t T$ | Z0D$/\$.PPt(Vh4?' PPRhiX|$\$&D$'WPVVt$"VD$P71҅t@t|GD$ | U&# T$ZJWUV ŋ|$_D$/Ѿ gffft&ʉK0T )ʉхuPPt(Vh4| ?8vFRh@hl$ U,؃<[^_]Ë 1t@  ut@u @1P_ơ tC   u jECu V! WVS hhV+ L$QIGI \$SNPPh T$1RA t@tt$ xD$D$QQT$"Rh E<[^_]ËL$ l$UMWWhDS|$W 1҅t@tw D$P]FQ hHV_L$QMue |$W)F t$VLtdPPh L$Q' 1҅tZ@uTӃ hUSSh l$U 땃 \$SE3 l$UE륐l`\d`HPTs܇48Dx(<dxÍ&UWVS,1]"WWhS S t@ow$ Be[^_]Í&WWhS Su(:E*PCQ-Ph0C QƒuEtuPpPKRh뛃t=t51s-tjPPSPVdHutSt1SSVP1K RBE]׉uEw u؋1UЅth]1 FtQU:uRRPEP蚍u҅x-vM ?uE]PP3VhY ?EԋEld h ?qUEU1ۋBEU 1ۈM GU:uRRPEP訌uΉ@uEu+Mt;SRw uz Rh} `];}CE둅QpPRhĉ҉E1/Pw Quz Ph}  {9Ut݋uPt9pPQh봋]PP;WhY =E$lEl SSVj =1t u1tt@WRz tw Rh}  u1, QЃUQtpPRhálv X1 É tt X1 à LPtX1 Í&l%1Ð&WVS1 j"V DžtI1ۋRRQPPhh R藍 @$"PFu[^_ÍUWVS$j\$"t? [^_]á 1P*U71  Y3j"螃 PVh!'5똉UWVS$U%6-( ED$\8L$\U1ɄD$hD$l|$\tSDŽ$D$|D$tD$x<\<%tM $RRQPGuV 9UM \$\y1ɁĬ[^_]É|$XG%uRRVh utGu*u t&GSЀ v.|$`$PPVh!(GuPP|$`Whl#}3=/ =$WSĬ[^_]à _j$P^_5$$VRχ{G*u `GC< v5L$`L$`D$gFQ7$Aw$"UURh22=8Wh-h!Uk 11t.q<'<" ШC S1҉؉11  D$dP<D$0D$4; D$0HRPL$`QP軄 L$4jIh,!Q螄D$XL$0TL$4TDT$xD$tҋ …%T$x. D$tVS$PQd =tqӋt$xT$t%L$xD$tPS$P\$dS腃D$xT$| =tAӃ SAY5PjjSWÅthP$V$QS裁ډ$D$h hLh!S:+ =tA15Ӆt ;mL$`\$g$A ։É11  D$dPD$LD$P;L$LIRQ D$`PQ莂 D$PjHh,!PqL$XD$LTL$P t0؋q<'<" ШSR$|$ t$dVWÍp;5KRQD$`PR݁  IjhdEQāD$XTT3 D1D$xt$t …ÁRt$x<t$t  D$$PT$$R\$$S$PQ$$ ) 1tA15؈t$tD$xŁT$xt$tkPP =tA0DŽ$DŽ$ S~t ;;DŽ$DŽ$$U=v -$UX{ SS$Sj%PhD$x#G|B~9 Pj"p{ PSh!,$=wB|=sߋ K1j"#{ PVh!,D$tGy  A0j"z PVh!b,D$|S$P$Q? t$dVQ}D$DD$H;D$DHRP t$`VQ~ D$HjHhGP~L$Dt$XTL$HTDT$xt$tҋ …%$T$x<t$tP S(N t$dV~|D$(D$,;L$(IRQ5D$`PV} L$,jIhGQ}D$Xt$(L$,T0(+5t =HRhh!R VS$P$S$S$SQbVVT$ R\$ St$ V %hh!PQZ=|B| =5 Vj"Ax PSh!)c S2PT$pRL$pQSfPPP\$St$VD$PPPSr@Rhh!PƉD$TC$<\tyFtu獄$t L$T)Ή$t$T~P$Q$P$ST$dD$h h7h!T$`R9;tDŽ$ ؍$R$$Å$>PVSPPSS!QS D$$PT$$R\$$SPVD$Dh%h!PRQT$L hh!RQvPj$PSt$<$9>"i,$7T$0 hh!RQ CT$( hh!RQP ujj$PSLx$D$8T$<9uK>"tyt$<\$8z S2V )<$ S2V(D$8D$<뇡 H1j"t PVh!,&\ H1j"xt PVh!&lPh;= S5(=hQh#+$DŽ$uUWVS l$ 95>^=G=T$ PPWL$4Qq=xt~u5F5À|$ : ؃2y: [^_]5H9}L$$:-t [^_]Ðt&-z-t}ztڋT$$@ƣu29tVl$$J t588tɋ5F5րzy@N|ua=x|$(=:%|:둋-|u ? W (|$(Rh#QKq?W(L$()Uh#S%q끐&tL$ÐUWVS T$$L$ ր:+%ǃ;   (A :aQQSV oMP:tU;tP# By<u15؃ [^_]Ív5N |u{:t@-t +y>=ou5Ct&tQ*E<-tEt<+t= ( [^_]ÍT@UT$ t<-(Q*E$ }t& h=# 5FY5;<7u  t)-( ?[^_]ËJ1 DumRRj@R)5z*؉-8x};0< D빀|$ -}(lt& h!?7( h`!뱍&'(ÐUWVS1T$D$D$RRh$U<AD$5w$d%[^_]Á북@뮁릋\$0D$0뎋L$T$s1ۋ5L$ CT$ :uRRPVlu؅h\$ É\$@ 55u  dUD 1T$ tO\$ 1 Ft7T$ :uRRPD$PjuЅxv4 =VVWhK$[^_]à 5V)ߋt$4l$L$>|$8% hc$b먃 hꍶWVSփ hf$4o^ @^2 I`w@@ #@:ÀNe|  F  FAFvFF$FF * Wj1[^_PPh$hp$mgPPh$hp$rmSPPh'$hp$Um?PPh0$hp$7m*vPPh:$hp$m@vQQhB$hp$l^RRhw$h$lvPPhz$h$lvPPh h$l vPPh}$h$wlvPPhUh$WlvPPh$h$7luvPPh$h$l@^vQQh$h$kGRRh$h$k3PPhw h$k@PPhz h$k PPh$h$wkvPPh#h$WkvPPh:h$7k@vPPhbh$kÀQQh#h$jvRRhh$jvPPh#h$j pvPPhTh$jYPPh#h$wjEPPh$h$Wj1PPhh$7jPPh$h$j  QQh$h$iF  P8 Ph$h$i hh$SF PW8 Ph$h$i hh$SF P8 Ph$h$Ji hh$SFV P7 Phah$ i hh$S?F$! P7 Ph$h$h hh$SFRPh$h$hF VPh$h$wh W[e1[^_Ív'T$BRWVSL$ ]D$$D$ D$P\$ST$RD$PȍT$=tiH $1ҋ(…t]1uK5t7S :W…uPPC0Vh$uɉ[^_Å1Ʌ҈u|$t]1u gtʋK R4uPPC0Vh$KɃ h0U t1҃[^_Å…dL$ƉH|$ x1F 1F1F1LF1 F1F 1u(F$1tyRRVSPuWWRQQhfh$Rqd@$PiPPRPPh`h$REd@$PiVPPRPPhah$Rd@$PmiPPRPPheh$Rc@$_P>i PPRPPhdh$Rc@$0PiPPRPPhch$Rc@$PhWWRQQhbh$RSc@$PhCl1PUWVS 1L$ D$D$ST$ R1ҍD$ Pj¸[f1JQ(t @K= T1eNjD$Gt$1wJG 1G1G1G1BG1G 1$ G$jjUhW ƅtPu D$ tNu D$tt V VA! WD$ [^_]Í( h% h4%PPRPPhKh$R`@$QP0fPPRPPhJh$R`@$"PfQQRPPhIh$Rt`@$PeVVRSShHh$RE`@$PeMPPRPPhGh$R`@$Pte PPRPPhFh$R_@$fPEePPRPPhEh$R_@$7PeQQh U蹲ʼn$,$) jjjjU,QP$($PPjV&UWVS \$ t;u 1 [^_]É S7ƅt^uV1u  [^_]Rj=h<&PPPRPPj?h<&FP^@$.P d봋uj 1S^= ŋZu;<(=tcFu@PUSR _u <(=t=F 8 uЃ S#@@D('L$Q VSP\$t;us[[[^PPjSƀ<=uPPSPPj|h<&S]@$Pb0T0^YRP…t@B1[[^É'SPP\$t;tPPj=S~XtZZY[ËD$t+PPT$RSHƒtۋJ1JZY[à S…uSPP\$t;tPPj=SWtRZZY[à S1ZY[Ð ~ à j[~ @됍t& ~ à j~[ Ðj-hE&hlhjPD$,PZ,ÐjD$(PL$(Qj T$,RD$,P<,Í4jjT$Rj D$LPL$LQ;PRRj2hR&Ph[@$P`<Ív'jD$(PL$(Qj T$,RD$,P;,Í4jjT$Rj D$LPL$LQc;PRRjGhR&PZ@$gPF`<ÐUWVS l$ |$$t$(PVWU_Åy ^X8t [^_]Í&UWVS 1l$$|$(QWUT$,R_Åy uX8uF~Ճ [^_]É؃ [^_] WVSt$|$9tu.D8Rjjh&P{ډljBAuz/t/ABAu;\$ tPjth&Sj [^_]t<~tL\$ SM_VjZh&jÃ.@?~/SHSSjL$,Q룃 h+St1QQPRRjRh&PM@$PpRÅWjUgUWVS$$/%D$tPD$/GD$/T$,l$Eu?9?/Č[^_]ÉD$.D$l$Et$D$/tOt&.9t/C€/%t F t&$_/uF/_Ot$/…%@G/FD$/t$T$t$FG9rD$Phh&D$(P hh&t$ Vt1L [^_]Àx/rHl$/…ÁRuZL$AD$At&#D83m~/9~//D$"C(@$_P>DË|$ G}멐t&t$ FL$ EAEt [^_]à KQ{1҃E]9}B9|0}(UWVS D$ D$t L$ QT$\$$D$t |$$wt$t$l$Pj.h,'j ^$$1C4$1F1;t$ vG\F;|$}DT$ 1ۉŋ tPPRPPhh,'R=@$PBË $1;|$}T$$ŋ1ۅu'\GF;|$|<$w [^_]Ít&SSRQQhh,'R#=G@$PBÉ\F $릃 VR1ҋ$9ډX}ȍB9| $t&UWVSl$0|$4uL$4AD$ X9]B1l$;|$ }[ET$GF;|$ }MT$4D$1ۅtSSRQQhh,'R,<@$PAËL$몋|$D$p[^_]ËT$41tD$4XPj.h,'j WۉD$|$G1T$4l$ EZ1DF9~T$4 1tWWRSShh,'RV;@$P@\$L$4;Y뭃RRPEP;UEB9~]D$4Xl$4T$t$EZFtD$[^_]à sV19݋L$Y}B9|\$;'UWVS t$ tQtK~tDD$$tLD$$8tCD$xt=D$xt/ P6:D$t& [^_]ÍD$l$(aT$(:TD$zT$ T$t18$xt#$xt P9$&D$$Shh,'|$Ѝ\8SNjL$PPST$S>D$ulShh,'SwvRRL$,QP>>D$&'WVSt$|$t(F1ۅ~t$PCRWh99^[^_Ðt&PvPPRPPhh9'P-5@$P:C u[^_Ð&D$T$L$D$?7& 1T$ v@ uh jPR5ÍUWVS\$,t$4l$8Se hh9'P1 @9|tT$$u(KFutu [^_]ÐPPCQPPhh9'SP 4@$Pg9FuUWVS |$ t D$ 10u 1 [^_]GT$ ut$(19}SD$$uU h= hh9'R9D$0 F XZUS9|t}uR [^_]à L$,FSZYUP9}ȃ L$,FSZYUP9|룃 Ud,UWVSL $` $d D$t&T$L$uT$,t L$, [^_]à l$8UjjQVhh(+Vr [^_]ÐUWVS 1Z,T$$t$ \$DXt.#\$ 1Vj'[D$|$0W['9D$|Z ,$"L$9 t"ET$)F9|4$1ۊDXu;\$uRW\$,SV*uʃ [^_]à 1[^_]ÐUWVS@11$A$AWUj'…uG%=@tЁ@[^_]Í U&=OPj`W$@Q ($@DŽ$@DŽ$@΀DŽ$@$@DŽ$@DŽ$@ Uh-$, P* $$@Q$( Rj&u$0@%=@t @1[^_]Ë$`@$@PUh-$, P<* $$@Q$( Rj&u$0@@u$h@$@QUh-$, Q) $$@R$( Pj*&T$0@@;$h@$$@D$1щ$@$ @1 u4$|@1ѡ$x@1 u 9$`@Qj`$(@RhJ&D$L$ -u-PUh-$, Q( $$ Rh.D$,P(L$0!‰%t uD$0)L$Y$, Rw&D$, D$(P+x.tD$ P#L$=wPPD$PT$L$,Q) $$@PT$(Rj|$u$L@$P@$@$`@$@$h@$@$@9t9~9A: $v T$(RR%L$ AL$ |$ l$@t$@Pj`$@Sh$ j`hWt$1D$;S֐UWVS t$$L$ \$(|$,uf F>YD$0D$+,;]CMt&1҉KB0 vBW#vB=v>H_1҈uD$0tk ȨtYj{0t 0Kt$t-K C[^_]Èʃ0Ktʃ0Ku땍&l$0 l$0%D$0t 0#S ~gfff)0dD$-WURh.S$%; [^_]à trD$0͉߃K.͉߃K.ut&ʃ0Kʃ0Ku wrY0]]t|$0|$0t$0t$0|$0C0 Xu͉߃K%.*͉߃K%.uυx2gfff&),)G0׈Ku10̈U]뱐UWVSD$dD$4T$` yGFl$ D$ L$$D$T$$D$T$T$ - wF0L$D$$PT$$RVS%kуÉ tlD$$|$POT$$RVSlvT$RL$QVSk#L$WD$$PT$$RVSjуÉ uD$dtyà بtg0t0Ot&l$4t-O у_?t$dt$dl$dl$d|$dG0 XډO%. }ډO%. u[\$(t$,xCjj T$4RL$4Qe0Ojj t$4V\$4SxdT$,D$( u jj VSh0jj VSgOD$(T$,WVS\$ |$$/wRRL$,QS[^_+vD$D$ |$ SÅ<WSVjN@… Шt1Ҋ;T$$t)uȃ1[^_ÉyUWVS1㋴$$t&QhSV裿t|RPSW!yڃČ[^_]ÐUWVS 1|$ t$$\$(PSVWJ~)Å~=PSVW2uE~ЋD$( )[^_]8t [^_]ËD$( [^_]ÐSRR|\$u@1tPPSS@$$ |Px1[Ív P7a벉SPPluSu =Ļ t_ |t tuDĻ@t huY[[ÉXZ[멍&QQjijUk뺡|t tu PmXZRStXPX$X`wSPPz( uGQQjjx1L$u(PPSP3@$肫$ZY[ÍvPPSP@$S$cXZjj jQQy$}$pXZSR%$_( =3v'P@Ít&PÐt&UWVS \$ t$$|$(CwMt&(t>o p p1CvuU1td Tc ~aڋ8D_tA1҈ڋ1뚃 1S ރuvL-@ƒ%` j&.qYXh hB.`XZh hF.OYXh hJ.>XZh hN.-YXh hR.XZhp hV. YXh hZ.XZh h^.YXh hb.؃XZh hf.ǃD[Í u ,u $P` `P *XDRF2fe j, \t @uUt&aW`Mu   Í lhPI)Љ lh돃 hyG"~`'t& LhIP0r P@Lg @HtJQQjjn1Ív B J%QQjjjn1Ít&SPP\$=dp|R1tPPSS @$$' |PNxP@L%f@HtcPPjjmX @QLuLt P`ZY[떋  oB PTT1ZY[ÐT$  @BJP LB J(  |BJ LBJ D B$J(< @B,J0p B4J8 dB   Ȩt)Kvˉ 9}ID9< <  Шu݅9   Ȩt+Kt&ˉ 9}[ID9< <  Шu9}@< < t)K9} ID9< < %uKMt N91 [^_]WWVSL'UWVS =t$$9}-PL € %uv*=\UUVjW*Ã\ بt,-45T`-\D`5 1[^_]ÍL € %36jD$G9 D< < /9}?T   Ȩt)Kvˉ 9}ID)< <  Шu݅9T   Ȩt&Kˉ 9}\ID)< <  Шu9}AD< < t)K9} ID)< < %uKL$IL$|${*=1 j*M> j L/ j?L CPPjEj S\$Sj$D`1[É'VSPt$9|15D`Z[^ÍHt , t#1C5D`Z[^ËQQVj;!;u  놉VS t$Vj#9|15D`Z[^Ht , t#1C5D`Z[^ËQQVj ;u  댍t&'j j/VSV iÃa بu,Ct 5, ~5, X[^á( tˋX@)؋ p9|-D QQ PQ訊 PPFPSSD2a( tsX@)؋ p9|(xmD RRPP$PP FPSQJD3X[^Ë ~ݍP 뎍P t& ~PPT$RjV DT1 Í&'D$T$0tD$T$M=8u uD$0D$8!&VSPt$DpuJ; ~/\$t&PPVjKuSSVj1[^jjRPR 붃 t;t1 v) , uPRjRP Nj I 븍t& D$;H1 Ðt&PPD$PjB 1 É'UWVS  @|$$ @ơ࿅7-XPPVUU=P5; PA -DPPUVwP-9~-=@9tH2DrP6}}&WVSVƒ Ѓ|$O59vv, um9}<@QQSjt@'5Ã濉5QQSjuOm1҉[^_á9}@RRSj5v , t~@9|Ћ RRPQ8;PPSj2  @ VÃ⿣PjjRPuxj' u |$ SDcPRRjcL$QwÍvSPP\$t(~PPT$RS ك 1[Z[Ǎ&UWVS 1|$ l$$9}4 tW9t"F9|̡u 5u! 1[^_]RRUj F1 [^_]Ðt& t D1  D B~ǀ` ǀ0 @lP @TP =u= u@D`  @ 9⿉Pw 1 Ít& @ ⿃`t%aw$ t1 Í@D ÐVSQ5F9}A jpL$ T$$4@V[^ÍJ@ RRQR.q5딍&'UWVS =1Nj5J EjOp 4@>|$~<퀌tH턌FT$9|J@ VVQSep5r- [^_]Ð&UWVS 1Nj5N Ejoo @ƣ:|$z<퀌턌FT$9|r@5RRVSo5n )111(D,Ct'C9~PP QV*oƋ h jSV[^_]Ë -념hSn1҃DB~ Ðt&S\$hn1&D@=~1ҊӈыDDB~ZY[Í'hm1DB~ t&D B~~@L ǀ @D t&D B~ Ít&'VSPt$t51t/C"ރu DPC~[[^à TR!ᐐUWVS Éօt8u [^_]x; W;;^PPVSSn É t5;à U:;; -U;];=@ÅQPj3V$M ub @ [^_]Ռt&[2ƌ [^_]SPPVRm PF1됃 VX:VUWVSӉ2P-5@(  u:R jjP$Ij[v , PPSjĻ@Ã⿉Ev , t# tr s5@5-l0==[^_]ÍPPSjt?Ӄ \$ S#RjD$PS,PPjjPPjj!0茊-5@{見==[^_]8u2PPQQRP@$i$, P~/-5@s' |$?J?A1 Ít&' |$/J/1 Í' tj1 _ Ð& t<1 1 Ív'UWVS ʼn /D$u$bt$ 8 M56D$ S6>^PPWVPi5É5t/6à L$Q06tY 6 áP 6X6$D$5T$!VPPWRho|$tZ5PVjL$P$ ut== @1 [^_](---@ [^_]PPSR]rf P+{t&VSQ\$t$=@ tw=@ tp4tG9} ^P PARPQzD*-t(ޅ1Y)T[^_1Z[^Ét$\$[[^Y0JRRQ Re^t&VSQ\$t$=@ tw=@ tp3tG9} ^P PARPQzD*,t(ޅ1)T^[^_1[[^Ét$\$X[^i-JRRQ Rd^T$tSuKt%<tVt %<t2t%<uD %<uD D D 릍SPP  Rjá Q8u4Ph jS&xۋtQjh`jNXZ[à h`$`TXZjh h`hj Rá j2 v'PJZYjP 1ÉP*ZYjP1ÉUWVS u PÍ$Pt$ VhTSPPUSsE u D =5<A3?4=125;9:==@5=|$P >D$ct%<uD D$dt%<uD D$pt%<uD D$ot%<uDг |$ L$$ʊD$%t %0$$00… Ш$%Ƅ$$Ƅ$u$L$Ƅ$8uPRUjSnxߋ-} Q5tPjh`ju[^_]h8u2t%<t%<t%<%<D  h$`XZjh& h`hj>$$IPVhTS[GD 8D D 6 jqUWVS$Pƍ\$PP|$ WhTVWWSV>C u|$D$#u_D$$t%|&D$0t %|tqD$/t%|uDг Ĝ[^_]Ðt&%|uD M8MĜ[^_]ÐPWhTV ,D D dt&UWVS$R{ƍ\$PP|$ WhTVPPSV C u|$D$#u^D$$t%|D$0t %|tqD$/t%|uDг Ĝ[^_]Ðt&%|uD 8NĜ[^_]ÐPWhTV-D D dt&W1VSt[^_à `PBPPh`Vmu޿  =W C8u@ShjVx1[^_8X[^_à R8uQh`jVZx1먍&SQQ1uY[[à P'8u+Ph`jSx1Y[[ÃY[[Ð;D$t%0!u=,Ƀ@Í ?uUWVSljT$D$P(D8$D$D$D$l$tkt&<9<$U)RVjIÃ@D$EPSjVEL$AL$u5l$$u;|$GD$ GL$T$: Rb D$$ t$ V<$D$PXXZL$QVY/XZTWRH$$@SRVjv1@t]$P1%=@= {=`====fډT$ Av$RSVju$@ V D$G |$ W D$ t5WWVl$U\l$EĬ[^_]ËPPRj^7_@ӋDQty1ɈًPPPR\$FD$\$Et& PPQj^ZYRj?봺?R` D$$ t$ V҃#QQjV*{t&/n t$V*`=$ÉD$$$VRPjJ1@t]$1%=@= =`====T$ %D$ /%L$ RQPj\$0@D$ /@j=^|Rf/s%g#[=O@C|7QQjS肿 *vWVS\$|$ S$$qT ƊXFZSPqt [^_ÉUWVS=D$D$D$i-tA1D$9|$}1t$VD$Ht , C9|ы 9€|$%tn5PPjSVYãtD5P RRQUvt‹D$ …%t PPSVуu PtkCQQSUtMt#RRSPt-)O~\$t&_WWSPҺKL$0t D$0T$\$4t t$4l$.D$[^_]À|$'P<\|$uuRRQR_psT$5'|$"D$D$=jjSPSVÃ99PD$8 D$=t$u:VVSUйvL$D$L$ЉŅVVQP҃볋D$D$=G=D$D$vUWVSbFA,u9Á L$1[^_]Ë.tt&@ GCt/PPKQP蹴u R+Cuу  SKNjFt9tCBu9t PD$ t] V| QW W Vpt$1[^_]QQoUPճu OQ:GuHh jPFP衷UWVSL$8t$0\$4L$ lʉt$|$\$Ńt|$9%)ŅufL$T D$= D$6D$ D$9D$ 1|$ 9;|$T$ ؅tJPPj/ST8xP9v:/J9w ؀/F9}%\$)Ã~t&QQPj yKuT$9R|$G5|$t'PD$J;T$9D$ Át$ Ft$ D$9D$ [^_]@]|$WӋ؅tJWWj/SE8x~P9v:/J9w ؀/|D$\tNƒÁtHD$)ȃ~Ðt&WW=Wj 8KuFL$7[^_]kBc=Wjjh5X5V%1 ƒ  ШqQ Ȩ@Ã⿃yY Ȩ nN ȨD;cFY@h jt$V\$$SL$A=L$PK;\$Pjjh5XR1   ȨqƒQ Шf@=Ã翃yY= Ȩ nƒN Шubt]k-aB|1Rt1tD$ջ΋D$H1t1tD$ՋD$HǍvUWVS(D$P_T$Bu@2t$؋xc[^_]D$$Ƌ=tPPj/V}t 8d 11S^hD$D$u]F<3tS<< ȨuT$) 3RPQT$R|ƒ@CFD$D$G<3u;|$~|$$T$C$$4-á4Ky; B=RSh5W,X5VO @ 0-心yƒY- Ш nƒN ШbYs덀xu H9vq8/uXPPj/Vtw8trxuH98/uX& ֋L$QxWGQ/X Pt$VS\$Sda[^_]Vl$USRЃ/IXAt&'UWVS|1ɉlj֋$t u^l$ ul$ u t)A)Y u_595…u+|[^_]Ë-u-PD9t\$ 끃 U|[^_]à WKƋ$t (t^|$PWVjuD$ %=@tW==9=%u! Vv|$PWVj胰렃 Upы-tNjtRP<u|/t</t h?RWVjciT$ @SkP빍&'VSP\$tE1u \$X[^ FQt܃ FQuX[^ÍUWVS1D$ j,@@ ,DVVSL$,QT$4Ņt's;t$uՃ PP\$PWH@뷅t T$,R\[^_]à W1[^_]Í'UWVSL (@T$`(P D$0\$85D$Ht$D$DD$?PPST$RۙD$D|$?D$,t$D5$=0D$(uoD$$ 1j,~>@ ,DPPST$8RT$HŅs;t$$uу PP\$,PW>볁|$8 uzQQWt$@VЃD$(D$,`US\$SL$@QЃÅ 1\$@tVV3V\$@S躦tf T$@RD$@D$@tx|$`*m|$`?{|$`@TQt$d(Vh5S肦El$0t L$1ۅt ,CUu V\$0pVVP|$8WP?Zt$<V :- g+\$l$@賩L$?…%=PPWS9E$Éޅt~tttk taD$?D$tD$?tQQPRotD$T$t&tQQPSt  V$M<u9tt VG\Et$@a5PT8)=Zt$@-PPT$PW\$KS=t$@ ]trth=t^ tTD$?1tD$?tQQWRVtt&tWWPSԣt  So$M<c9] SnD$@xt$@A8 JT$ 8 JT$ Rt$CVjSЃbVT$CRjSЃ_QV\$SUЃvj*Éj?É,u,=0 t; 0u!,t?D$@&D$!svuD$?YD$ LWVSL$|$uc8~DÁRHRPP%@$t6$脨 8P@艥董ã<5@t 88uPVRQ聣uąth 3V諢$5Ê<^_=H QV=D~t[^_É P.1[^_Ít&'UWVS l$$\$ ;LHT^PjXvWWSS@$35$CP;uVVSS踡@$5$TQQj/P薣 Å#RRPPRPC5TTPPVS\@$4$軦XT8~*  5TV| LPS\ 1Lt8 PŅ=\=}.tT:.t5X>~ =XW\}Ɖ<$O\0$3-XXZUS袥X|0/t/F3UUWR肥؃ [^_]á賤uӉDQt芛0舤P2DPX0; ]S艟9PW=PSW_&P8Ec uV;9LPWVS부}.x}-f}."^9_zluSSVV@$32$C PTL PxP P_X PFy. TA hTЃ$ XQT^T_RP@$k1${X hTЃLTPX1 P ;-TXUq=TV }R<$uL0 $0XZTRSȢ-T|5/&/F3 P1X PP9 PT PLUWVS=P `dt+1t FR],u SJ (lhd%(L$|£tD$xpVVPR(-x`D$|$ pt=$-0D$ t|$ D$ 1j,.@ ,DPPSl$UT$$Ņas;t$uу PP \$QW.볃 PD dtl3dd1[^_]SRQT$RЃÅ &dtd蹻d!`d`jWWh|t$$V%xt!t$0=ht$0T$0hhuKU-MUVSO9i S X8 N8 uN8)RhxjWЃLSL$\$ ȅx5Aw/(t%DȀu$\1[ËDD4\1⍴&'SPPL$\$t%x!Av4DD4\QQSL$Qn1[Í&(t¡Du͋$\빍t&VSL$ t$T$Dȅx8ADw8(t/Ȁu$tt&1D[^Ðt&D4t܍L$ȅxXAw2(t(DȀu5$D1ËDD4D1Í'SDL$T$ ȅx=ADw=(t4Ȁu$Dt&1D[ÍD4Dؐ&S1ҋD$L$ 1 B"<u9DuDB~މ[ÐWVSL$t$|$tt1ۅthtb1҈Š<uB|tZCLt@Єy܃=(tӊ<uE1҃Š<tt؉D[^_1[^_Ë D넅tDޅt[^_Í&'UWVS1T$0D$t&t&\t;T$L$4 BT$E\$0+uދt$8l$D$4.(1[^_]ÉEL$0\ tԃCƒM ШuWCЃHw?$p;Ml$0ÊT B<w!A|$0\ЍB<wNuiT$|$4:Y|)-uο8ua\$t$43s\$9|$0/DPM1҈ڋ|$4>D$0<(MMCT$BL$0t$T$)?t&Dxܒ1ɈًT$4yD$耕u(D$01ۊ 0D]O\$QDD$vQDɀD$v эLЉL$F륋L$\$4\AL$L$t$41AL$T$D$4D$|$48@D$L$\$4AL$T$L$4 D$T$4 @D$xD$|$48 @D$bL$t$41 AL$LT$D$4 6t3L$nt$4T$1AL$D$\$4E@D$D$xÈb'UWVS 11\$$t$,t;u|$ 3 [^_]à SD$I"D$ L$ QT$ RSR/1ɋT$9D$1ۊw(tCw&A $9}l<t<lbDtttpu154 $T$9m t$V1 [^_]Ê<tPtAT$ L$(މL $54뵍& u놃 D$4Pt봃 DP뢋 \$Skl L$QT$RD$Pj7Ív T$RD$PL$QjÍvUWVS 1t$ l$(1ۄte=(!1Ȁ<u5|t.CTtCtHt@UUhQ6S"tpVVhy7Su=T5,^VF7v< <  ȨuaC1fu1F3D$tu\"uߊ 3L$|$5 =-(h:WSh8Ui W 3t €  ШtF 3u,3l$UT$'€|$" Шt0l$F1Ҋ 3tt1F\9utF 3t2 € tF3t< < u13;"PPj-Sm߃tx`1t',`PPUWenF`uي׋ 0|$0tQQPS>[f.u$$tPPQS[eul$]'€" Ш t$VjL$D$L$tT$8\uD\$ C=DSjT$ ƍD$PVSw V+J=(Phi:h8Wf+,|3=f< V$FST$:WWh:l$UluP\$5D\$D$VhL$Qjh(Sh:h8P"fv851t&,RRL$QUROlG,u1ɋ|$-t$ƀF(8DD$$LWV|$Wj2 t&C9t8 ut €  ШtFKu€#u5tC9r UL1|[^_]à V, c|[^_]à P WPUJjÉ,$ax \$ P٬ VȬ|W1VS=HuHPPj D$5P&`=tSD$5=[^_Í D$t8u:1҃ au h:Zuθ:Ǎ tB8u:1@tu D` ÍD à h:u:룐UWVS ljօt 81 E!P(tCreveCrse-C i-seDarchfD)`D p tRR3WRh3': PPShn$ Ļ[^_]፴& PcW'UWVS\ŋ5@΀5T$$D$(D$ D$L$'D$,\$ 61t@ u 1RD$@ L$0C9| rt$0 Gt$ <$1 D$@hlD$LD$HfD$ jT$ D$L -Pl$$ Ua-D$(@fs=Ã翉=dv , "xKD<u@D=@c =0c = %YPPS|$Wz\dvW, uNx7|$@!‰%t u)ItC$<xÀtKƒ Шtǃtƒ SrWW5P|$(D$8RVet P\$8L$<\$ 9\$QQjT$()Vt-^D$8;D$4b, |$@1ۉ!‰%t uʃ)L$P< L$Q 1WU@$D$$D$ D$4D$D$(D$,D$0ƃt{tu<t<qXv ,  FT$ D$B@T$ D$D$uT$ ;l|L$D$L$vCu\$ ;l}|$|$l$(t t$(D$ T$@t L$@\$|$Dt l$Dt$uD$Ht T$HL$ D$$,[^_]ÐL$AL$[ECzT$$)1HCD$e)L$ jjQWqT$)ЃPJCFutT$ D$)KȉD$T$ )ЋT$ ‰T$ KQT$T$‰T$PPWWS@$4$DYËT$(t PSL$(l$@t t$@|$Dt D$DT$HtL$(tl$(Et$H SdS却&WVS|$tk?tfSSj WTƅt}@Rhjh ^Fjhj^[^_1[^_É PgP PV2QhhhR띉'1ҋD$jjjÐ&VSRt$9tR;5PJ)‰Ѕ~D~PPPj sUKu XPh jQ5^[^ËTt:t؃~ËTPh jRNKuWVSt$|$xTHt ,  9˅u)ÅtȍV)9|@t+;lu# XSh jQ19S, X1Ph jR9} PPQPC/T9|Sv , 5[^_à 1҉VR 9 cSv , tK )Rq떍9}PPPRCS9|a 1҉V ) $맃 1V[^_Í&'VSVDt$u6t.9}QQRj SKuX[^Sh jP, X[^Ðt&VS|PHO@w05PPSVTZY SQT|PPj RQ ƅ VNQv , 5@l։~tl1195 B9~1|Z[^Ë 1|Z[^QQjhUn끃 1҉S6|5|v t#Ѐ:t@8ut t @@Ļ1 ÐVSP\$CwD %u(t#RRPSPX QI[^Ë QjjhH6zQZÀuRQڃ@DPtNڃ@ӡRRPS"PX QUI[^Ðt&?ύ& fQjjh8PSSSD$T$ÄxO< t>~)t+P1҈ڋfQZY[éuиZY[ÉЃ)@ZY[Ð=D@쐃 T$RD$Pjh H Ļ1Ð |Ļ1 Í&tt @|u=1Í     uTu`     Ív Pבt P‘뒍'VSP5 5 u:|1 VRÅD$D33Z[^1:uh ^S\ÅuvD$D33QQSSH@$5$EN5 F؃5 Z[^Í RHƃ ^SÅtPPRSMs8 PVHƃ VRÅ |PPQSM'VSt$Vh~ PPQj KKu Vh~IXDu5F5X[^Ív du hRh jPNÍv'UWVS\T$0D$4ҡu=);lQJ, \$xD$t99ۋt$4|$0t$4l$0\$(T$4)Љ;D$t}}t@E;D$t|D$(\$0)؋|$(;D$x} ?t@G;D$x|99|$(%\[^_]Ël$0\$tt$4l$(~tT$0:z&FD$(L$4@)ωD$(;|$tWMT$(:t@5@\D$pH9I ,  -T$pt~7D 9}=PPWj KIKul$PD$PD$TU H PL$8Qt$XVEƃ@3 1ۉ9RRRL$<CPH9|L$PD$PD$TQB =H Pt$7PPT$HRSD$@PUWL$PQ[ jjW|$@WjjSNjt$LVL$Pt$TÉL$H T$4);D$t|D$Fv, -_U\$$D$(9T$,9D$$t E:Gjl$,|$$\$pD$u D$;D$pt|T$p;PQ)‰ЅW~Ӌ PPQj FKuXPh jR\$pL$put‰D$ t PBD$ L$4D$p)˅\ XtD$ ;~s҉T$;\$ %tTD$;HPh jQXZ T$(RQb*Ev ,  T$ vPPT$zL$0lT$4a<v, \$,C\$, QQPj Rh jP/@Rh jPRh jPut PPQj <5F53jjT$4D$<)‰T$4L$4QP\$D؉D$<]Rh jP T$XR<DžEmt&RSSP h SPHjjL$,\$8)ىL$,D$,PSsT$@ЉD$4 1ҡL$,Q0 \$@S8XUWVSLD$ X1D$,D$0D$4=8t ;|  Pn7Ƌt ~}T$4C;Ȼ|K% ȻWWPQ=ȻXZWPD$@W=VWD$ 9=j l-SQjم);lD$4)u)9PPRD$8)D$8|$8Wn5 5V--= 5\= - -L[^_]á=fitt @X1D$,D$0D$47t ( tt$0f*D$4FPPj Sw1ރtp)߅$ VP/ã|$48B;Ȼ|K %ȻWWPR ȻXZQPD$@WSVD$I< <  ШtKs9t$t3SSVl$U]ZVË|$W!+9t$5F5=@t 1[^_]( 1[^_]Ë 1 @ [^_]øt&'UWVS 5D$ t$<YhPL3 ƒ  ШN5L3tx ƒ  Шuރ/tمt] ƒ  Шƒ/t:~=Lt# ƒ  Шƒ/uME9t$t3SSVl$UK]ZVË|$W)9t$5F5=@t' 1[^_]Ã/3& 1[^_]Ë 1 @ [^_]ø&VSV5u &1^[^SSjVZYjV(@=@u1@^[^Í&' @9t&QQPR%@9x@1 Í&VSV5@9~9t>SSRPZY @QR(@9 Cj(51[^ÍvWVS\$5@Q=QjS/XZ@jS1@9t&QQPR@9o 1A5@=[ ^_ۉ\$[^_WVSt$@Q=QjV0XZ@jV'/@9t&QQPR|5@95@B1=[^_Éۅxz5@Q=QjS.XZ@jS/@9t&QQPR@9F 5@A rWW\$SV[^_Ív'  t- Q%WX   Q$1 Ít&'W=0 VSt= t e[^_Ë t5  듉' 4 u41 ËB J4  @ R< >4 t@@  uJ R>< 4 @ u4 u1x@@  Í H  D B9|M8 tpPPAPD RH 8 D$ H  8 BH  Ë 8 D$ H  8 BH  Ðt& D j 닍v' 8 uD4 H D uZ4 @  É P'=4 8 H D t P< SQQuH 1ZY[Ë8 tSSRR@$$!$ < @  4 PH< 4 @ ZY[ÍvVSP8 t$r8 PP8 SP!@$p$$ Z<  @ 4 HP< 4 @ Nu1[[^ H 8 YH 1D[[^%@VSSH p)؋ 8 @H 8 ңt${8 PP8 SP@N$b$r$ L @ < H 4 < P@ 4  u1Z[^ H 58 PH D017 Z[^Ívj 超 < @  4 PH< T$ 4 @ Ðd 9h %Í d h 9~()H1҅tJx#D$d  )ʡ)ҋD$Jd   d 9h %ÍSd  h \$9~2)ȍP1t%t>A ;|!h [É)‰Ћ)ãh ⡐ d뢍&'T$~ÍWVS,5V$1҉ƹ ߉ |$ T =D$|$ FL$$QT$0RjSPK%@[^_ UWVS,5$@~ -U91҉Ź $Љ |$ T =D$|$ EL$$QT$0RjSP %~5,[^_]Í&WVS BR蘂NjD$ #Dd <uA| u7 >Fh d 9tM1ɍP ;}Dd <td 9~;)HtHx8d d   7W_<$w6[^_)ӡ)뿡H'T$ d1Ít&d%1Ít&UWVS,p@pdt2D$ dD$ ,[^_]ÍvD$ u` t&d 9h ҋ5L* -U ʼnэ$э|$ L D$D$ M|$$Wt$0VjSQD Wt$VhTUǃT$ d h 9ȋ5)H9~D$9}D$GuN)ȍPt*k A;5h    Ȩt$Nt$F S h Éơd 9)‰׋)s;VjjU QjU jD$PU D$SjU}T$t`d  h 9)ȍPt<-A;d-Ɓ  h ` dh ؋5)ȉ)ʼng- d-od 9h 1ۍP ;\$ |Fd |$_T$9~^)ٍAIttC 9$d )‰׋)L }h ؉))ʼn뛃 5VD$G  d fvVSS\$t$t&QjVSN$tNt t tуZ[^à S$xQjVS$u1D$Z[^Í&'UWVS1|$0D$D$D$D$ ;t$4}pl$&u_;t$4}Y @F ;D$PVWUxtuD$T$ D$T$;t$4|[^_]ÍvUWVS1ۋ|$(D$,t$$PjW;\$(}Y却&$EPPUWTu,5C@57 ƃ;\$( | [^_]ÐS T$\$RhTD$PufD$ $%l Pl~fP=l~x lPPPQS_=@l Pllȉ h[Ít& t h=ljPylPet0K = h=ɐP# h1VtMjj jPDP릃 h1Utjj jPl-l#PeSL$\$ … Шu ؋@ PuHlh[Ðt&SL$\$ … Шu ؋@ PuHlh[Ðt&T$L$tPtlà u ËPPjR8$=Ļ t Y'WVS\$ d1DXdPl=Ļ   D$  P P@jWl>P1X=ht<\p |LT                8x=< =8 1[^_úOlOP PPl =Ļ  3  5  t$ PPSQ&1ۍt$ t&PP VP@$Cvޡ`1 t5x TX85<  8 u X= 1h=見@SSjW+=t1upu <t 1h=O u  VV5 Dh DV^U XZhp QKU^ _h P9UXZ h R&U^_= h WU5 XZh VU ^_h DQTX Zhp PT^ _h RT= XZh WT^5 _h VT XZh QT^ _h D`PiTXZ hp RVT^_= h WCT5 XZh V0T^ _h QTX Zh P TD1[^_à PP(= P?( h=j  hyG=O hvs  h\s  h=\UVSS 1t$t;1ۈT$ vCw, L$8uRRVPuۋ$Y[^1Y[^Ð&D$P1Í'RD$PÐ& QT$RjD$PÐSPPxT$t%~Pxh jP跜Ku1ZY[9}Ӑt&PPRjXKu1ZY[Ít&Pj 81Ív' t,tt1 á u#PP(Pj;Y(R1Rh jP鍶 t u ÍRh jP› Ít&' L$t u á tRh jP聛 Ív' L$t& t|$tu+Qh jR= Í; <u썶Rh jPӐVSPt$> V'Å;LPI9}QSV5PP 0 ut] jQRjڋ5P؉Z[^1Z[^à R/d ( tyu9QuЋq)BA닍vUWVS T$ |$$9~Љǡ9~9zӃPP!WSe)ރ)ʼn9PA2)9 0 u0UWSj)=P[^_]É낃 Ua#=P)[^_] 9~2D$t#@9~ @Ívy @Åy UWVS |$(T$$G9~|$$9~ 9։!RRWV)š)؃9t&PA)9 0 UWVj==)ߋP=;\$$t$ t D$ 8t P&ƅut&{1ۃ [^_]É:0;L͡PIUT59}=PPVl$(US 0 utw 2jQRjj-PD [^_]à U(! RC ( {yq9QhЋY)؃Xzy^t&VSt$V;L}tPPV5PV-؉\$uD9~*@9~ @Y[^Åy@Y[^Åyy밉 P{ SSSD$|g~M Ѕ~@ۉ%)É9 x1ZY[Ðt&Fy1Չڅ|)~9|2)Уy1QQT$RPPZY[Đ& T$|M~9|)Уx"1 Ít&y1 ډT$ v'VSP\$t$Ht , tL ىЅ~5@Ӆ%)É9x x^1Z[^Å~ PjSRQná95@9y1떉yڅ|x~9|8)УU1Fۉ\$t$^[^P!뾋PVjPSoIKPPVSRZ[^Ít&'VSP\$t$xHt , t4~9)أxl1Z[^Í~ ~li1ːt&VjQ PKQOn…%u빐t&1눉f1 eۉt$\$X[^PPVSBZ[^Ít&'T$RD$P^Ív'D$PL$QÍv'1Ív1ÍvVSP\$;tw P 4VucB9|9tCB9}15P Pt Aʉ ; |K{1Z[^Ë릉ޅ|}ttًP DP{uJuNu1먋tP LQ=tӋKډuNuVVL$QSZ[^Ív'SPP\$t?t5 P DPѿu JuKuǍ1ZY[Ët P DP茿t̡H£uKuۉ\$[X[ 舶 PXPZPj耀$41 tC. PXPZPj&$ځ袃1 Éˉ膃1 ÍVSP t$@ Ã⿉ڋDXt1҈ڋBtq~CtxDt"`1[[^ÃAuPPSVL-1[[^~9) y롐QQSV.wY Ѕ~5@Ӆ%)É9W >/ , uPPSV+, 1PPSV} K4څ|) 9|)PPSVfPPS'UWVS<1l$P0~Ht=, %D$TD$D$D$]8Ht-,  eD$Tt$ D$ D$  VÅ;Lʋ=PI9}-PRSVP 0 u  jQRjG-ЋP-1<[^_]Ív ŋ D$Th   AQh T$5 R a5 D$ND$5 ]  ^t$ 1ۍnU`9}!l$PL$QUPT$9| ? W0Å;Lv͋5PIUT9}Q PSWP0 u  jQRj5ՋP5-+ WW1<[^_]Ët$ 1ۍ~W_PD$ PT$RQdD$Ã9|߅&~\$ޅ;? WÅ;L&PI9}PQSWP 0 u  jQRjM ЋP v) W1  Rҹ:t$|$ VÅ;Lʋ=PI9} PRSVP50 u 4jVRjT-ыP-  1  5 -  Rθ R踸 R袸D$Q Qh Pv=  D< |$] t$`V@1K ( y9Q+ABA  KT$D$D$ VSh h Q ( 6y,9Q#Ջq)BA ( *y 9QՋA)Ńzy ( y9QЋq)zySPP @ Ã⿉PPSD$Pq[Íj D$PQÍ' L t; @҉ tHTt tu1 Ít&tt81 É TPuQ뗃n1Í'UWVS 5l$$t{1;|$ }4\$ QQUjUX PZPPwzKu|$ ~E-PPUV; 1[^_] [^_]Ëu-9~9~ 9Ɖ!PPUV{))ډ9D$t&PA)9 0 uST$RUVj-)݋P-+;"RRj W t$VL 묉CvUWVS \$ t$$=~fIv, ~9)أ-VVSWS1 [^_]ÍuHt , 5=PN 9D>D$ ~ϋ9~9~ЉƃRR!WVӲ))ډʼn9PA)9 0 UWVj=-P)߃=D=Ht, ;1ҊT$ 0DV@VVSRxw${ۉ\$ [^_]-qv_PPVSMPPVS:-5PPjUV\ P‰\$9~׋9~9~ЉƉ!PPWV>))ډʼn9PA)9h Uq r UWVS \$ t$$=;=>Qv , a+ ىЅ~5@Ӆ%)É9 -PPUW:= [^_]Ëm.Bщ9~ס9~9~΃RR!WVԯ))؃9PA)9 0 UWVj5-P)ރ؉5D57^ۉ\$ [^_]^څ~9|y)У vPPVS=, P jjQRjX UzPPVS0t;UWVS\$0|$4~ , <$ U虿ƅ0;LPI29}PQVUPk 0 u  2jQRj Ћ5P 9|\KD1[^_]á, PjT$RW&VVWj9}QQWj 뗃 R. ( &y9Q+ABA T$D$=<tD$T${t&' D$T$x4 t8 <uT$D$ T$D$ M؉D$ / ÍvL$T$t9t T$L$t&UWVS tB5P\ €  Шt&YىtD1[< <  Шu݋59}D=P À  بt)Yvى9}[D;< <  Шu99~ȉ9~ 9Ɖ!PPWV))ډ9D$PA)9 0 u9T$RWVj=)ߋP=;- 1[^_]à t$VƉaL$T$t9t T$L$Zt&UWVS 5 -t>t V艻Å,t&Ļ= Lt;-@-Ttu 5tv= 1[^_]à VÅ=PT$ :tuJ|$ ? V论Å);L59} =P,9IUT9}=PUSVAPSWV w<99~ 9~Аt&Ɖ!PPWVk)š)؃9 &PA)9 0  UWVj荺)؋5P* TQ[O諮E[ 1[^_]É!;Lʋ=PI9}Q PSVP.50 utj jQRjڋ؉USi U RWV ( tyu9Qu׋A)ǃqjiwt& R=Pt&UWVSË5T$jP-PPUV軻D$9}H=P|$7E|$荼ڋDYt譹1҈ڋ7F9|-1 [^_]Ít&|$L$u=@ڋDXt`1҈ڋ7 P<0W蚤FD$ڋDYtڋDXiȲVk [^_]ËD$D$D$UWVS1-\$0|$4u[^_]PPWSD$ƒ0օt8t2P LQ詣JuKuʉT$PPWj,\$9t$9 ШWWL$Ql$UhD$(XZ|$WVWD$$5|$9~9~ 9~Аt&Ɖ!PPWV )š)؃9 &PA)9 0 UWVj-=)ߋP=;t$T$: RÅ;L0͡PIUT9}5PQS|$ WP 0 u J jQRjr-׋P-=;&D$|$ 9~|$9~9~ Ѝ&Ɖ!PPWV苢)š)؃9 &PA)9 0 mUWVj譴=)ߋP=;t$T$: R蘳Å;L͡PIUT9}5PQS|$WPd 0 u   jQRj-׋P-=;&L$ A t$$VXD$ P1[^_]ËaP LQ۟Ju- UA U3T$P LQ臟u/JP LQXtыuP tV0JuA Rv R`$KPPWS}5- ( y9QՋA)Ńrq ( y9QՋA)ŃrqO'UWVS 1t$ .]=P諳;茳H= )SRC1҉Ńv5PƊ LB9|D<9~׋9~9~ЉƉ!PPWVY))ډ9D$PA)9 0 T$RWVjz )ًP  jD$$P5PVSG9$} U;ƅ;LvϡPI79}PQVUP 0 u  2jQRj蝯׋5P=> Ub1 [^_]Ë-,  5PPjQVGt& [^_]Åxg |$Wv Pǜ v , tu=O=D$ Lh ( y9Q׋Y)߃BAt&PRjRPFv&'UWVS 5D$$l$(|$,D$T$ \$$CD$$~ ;5/T$jjV5PVDƋT$$y!jjV5PVD9t PWUPVSVD tŋL$ T$$I҉L$ x}|$$T$ ? 1[^_]ÍPPjVPE9 PWUQVRC t‹L$ T$$I҉L$ y|$$uPjjVSCn PPjVQ/E% [^_]áPQjVP E2vVS\$(jt$ VxPVjS*$[^Ít&PVjS$[^Í&'VS\$(jt$ VxPVjS$[^Ít&PVjS$[^Í&'T$;@1Ð&T$u;@1É' @;~@ Ãt@1 ÐWV h3Q8~t8u h3't8uQQjj舧tqRRPjwtXtRCtCPtW@(D^_à h3mxut&1^_ø=WWVSx^51518=@B4QQPh.j]@⿉É:D<u| ڀBЃ wv5t 8DZУ88=@B\8^\[^_Ð-84u 8 8@չ=Ã翉=]Z\5=DRRWS5虔[^_][^_Åt=8u u럍vD$ PÍv'148 [481 88~&'SPP\$tu\$Y[[vXZ[à P\$Y[[t&SQQH tu S_ XZ[à PE S9؍t&SPPt7( 9Pt,PPRPP[$S X Q$1[Z[Í&SQQ tTRRjS ۋC( tu= S1 ZY[Ðt& 1ZY[Ðt& Pg뵉SSS t1[Z[à j 8 Pã XPZPQP@$8$诪(  P1[Z[Í&'SSS tu S 1ZY[Ð P S ՍS\$jRC @( u@XZ[Ð@XZ[Í'SPPt7( 9Pt,PPRPP[$S [ËQ$ tPRRjS ۋS( tu7 S 1  ZY[1ZY[Ít& Pw뻉WVSt$=~  t8( 9Pt-PRPRWm$e [NjP <$11ۅt&ÅtNu%t RRj;Ws@1ۉ5(  uˡ t>t49~ȅu<=D`@1[^_Ít&މt$[^_Ju։9@ʍt& j 5ZPY  PSQ"@$q5$聧(  PukBS9tK/1WvVSPt$Du1^[^t7( 9Pt,PPRPP$[ËQ4$,=u` RRj0V? ۋS( t S IÅtNuPPjPK@ ( 1ۋ 5 9~ȅ=D`@މt$X[^t9tRuۉz PJu9t@A멣i1⍶'T$RP@$ Ðt&D$<Í<@L$Qj1Í&1@<D u<<1Í&T$%<1Ðj62¡  JB  J BtBЃ ÍvT$B JB  Bt  Ív'Ðt&UWVS 15 D$t<t6 EP_[S L$хL$t uʋD$ [^_]Í'Ív'L$; % u  u1ø Í Ív';t t Ðt&1Í'1tJ Ít&1;tB ËL$)щ; ƒt tÉ1Í' D$tPu1ɉȃ Í 18uJjj jQޜ VSQt$1tu-Fu ^V*؃Z[^Ð P܉ PʼnWVS@ |$Pt ;  Y9Pr5 j )/XZWWƛ@$/$%F$PPh=j?\$ S _XSً9!%t u)ٍAP.$跠 F t@[^_à  2h\. tNj tupCuw S 19} t4B9| A Q2  SSRPR.  P6낃 P(xVSP t$\Cu#PPVV"@$q-$聟C[^à PPPVV@$B-$RC[^ÐUWVS 1l$ |$$;-}g j -á Y4XWW袙@$,$|$8N{XZQVRy@$,$؞C  [^_]Ð&VSD$ 9}0t, ‹4DB9|S[^Í1[^É'UWVS D$ ǃ!ǡ91)T$9}V5  Cu9 S5 E;l$}ttӃ PbCtǃ PO빋5 1)-BA9| ==  [^_]á뮉 t Í&Ð& Ív'VSP19}a *CuC S F9}0ttɃ PZCt PG믉X[^ÐUWVS Ƌ*D$T$D$ D$D$PUV,t1;T$0t' v , tZ<\t=CuՐt&|$49… ШuR<\$ D$;[^_]L;L$0CWW|$W<WI-~\C뎉ك )1AQ)D$ D$B 8G9} \ul;l$0uB ڋL$9T$8Yl$8}ߊ\$ <D$;[^_]À?\ D;D$0CCvUWVS NJ1ֈD$ tPPSh=t F [^_]PPSh=t?L79ƒ$%&=>V(`|$ $u|$ t\$ PPSh=蒐t F݊ 7L$ |$ n|$ \|$ \Ã'%td"t2FF7҈T$ ƃÀ|$ < ب]|$ &J|$ >€|$ < Ш|$ $F UWVST$\$0ۉD$ƒ|$%t L$0t$D$D$D$1E|$ / €  Шuބ:  D$l$ ;;D$ |$0ƒ|$Át%t$ 9t$9l$%t \$0T$|$;|$}nt$|$F\$ t$)ރ VR% VL$ D$QS袖3T$|$\$ +D$[^_]PPt$ t$ D$ PL$Q&D$ g'EL$)5RRPVUuD$jÍt&'UWVSD$4l$,\$0j11Gu(,$$C99$ Ш 9D$ CP)L$;$TT$|߃ \$CS_$1D$;$}@PPPL$QR R֐ ōC;$}\$D E+;$|19} ,CUs9| VcD$ [^_]Ít&D$뺍o_\l/UWVS1ɋD$4l$0|$8D: ujZ$L8-=AЈ< wG1C<$t|?ˋT$4,$>Å%t>= t{ VwY5 [  QV芎@$!$Ƌ$@Q u+`Q $,$… ШtHPPjV׃Å}̃ ==V1Ƀȃ[^_]ÐTD$D$QVSU#XDZVP$\ZLD$ QQPRd5)ˉ5L$4 KSQWT$ PVn\C$L $ǡ  5  ڋt$V0ƋL$ Å 1ҨuP1ۋ,9} CRL$ 9|Y t CPl u VY [^_]à V9 P)P P,UWVSx׉D$HD$TD$Xhi|$PD$,T$F7, PjT$HRL$HQ"l$Lt$@L'ƒ" ШFD$@Pt$(Vj$jÅ j'GMF\$>:D> h=Pҋ$1 D$(P!Xt$,V|[^_]D$,xvt$@\$<<3:mSSj/L$,Qt@RRPP@$D$TXT$,Rt$0t$@뢉s^\$@   |$,W蝅9ÉD$7D$1&L$0;l$%t<\$ +t< <  Шt E|$ /uD$ U D$L$ ۉL$  L$ 8)ET;T$u|$4D$4t$@UUj.|$,WÆt$@t&D$,qsv\$(C\$(bPPj/D$,PzSSj.l$,Uj7RRPPV\$F$PSRQ&5 T$)ރ ֍~W` UL$(QP   PS/S  L$T)щL$T$R L$PS·7Xt$,Vw|$01\$4t6  D$,Piv\$4CD$\$4 _vl$0rl$ |$,W;D$̃ V'Xt$ tft`t& t, FC&tDt>'t$ €  Шt'C'KF'C\C'C'F'C ^L$HQ蒂9_蒅v , ?D$@l$<tD$@Uh jVT$PD$LÅw Y  Qh jVT$PD$L RRj&PT} 1 5  11V&;- <\9 L=EC;  <&u΋ L9/ PPQRۆ 붅}|$\$@) kU SL$T$DRPJXDZ:D h=P耆$76QQRWNj 0|&%/ 5 V= - 4rPPVWr P_f|$8\$@) sV SL$@D$DPUrXZTD:D h>R觅$/ l$(Uƃ )VRf VD$DPSYL3_3:D3 h>QQ$먃 P  t 8  dl$\$@) KQ ST$D$DPV}_|]:D h)>W賄$uWL$LQ\$HST$HRY[t$PV|$Hl$LWH~ 1D$@D$@|$<tySSPP~@$"$2 P~   UWVS\1T$t= N D$ hD$0D$, $S<~$D$H :t$p11D$8D$<t$D$4v , \$4T$p tt 8T$p L$8-t<\"% tT$p<"u~T$p<'ulCD$4AT$p <'uˉL$4UU|$xWt$|V}@$f$v$1\[^_]Åt|L$p<\ur't T$9udCÉD$4t$pCD$4À< L$|$pD$8Q UhZYt$xVl$|U|cCt$pD$4À<eVV\$@ST$|L$@RWt$4HWt(DZȡRRQPgw>|$p<:CT$p<u\$4&PPV5V)wNVVS\$|SЃ\$4# \$4S D$(T$(ֈJ B:BsXY|$xWVƀD$8D$811D$4D$ D$$;D$(}?\$T$$4D$D$$H9~a/GD=D$4@D$4;D$(||$t/l$p9l$t T$$RL$t$ %\[^_]PPT$@T$L$QU`ʼn뀍&}6, (D$@D$DD$HD$L1ۈD@D$8D$<QQL$@QD$LPuT$4L$CBD$4D ~L$@t&!ډ%t uD$@)v}1!%t u΃L$@)΍7;\$|#|$|$;\$}PPT$RU, PPDL$H)QP~M 9 9t!"@<\$4t,L$DRRVP0t D$4)@P D$@[^L$ PPD=t$8)VP}[L$D$VPUj y@t*1ۋ|$T$t \$S&|[^_]à PкD$tSW|$WU@xƅw Uzo$xl|$1L$9;$%tO T$9;$%t'Q9 uފ\$8Yȉ$닉9s\F> tt4: tv S3L$t \$SD$E;$} FÉ렋t$ t l$U|$t T$Rй1M\$ jjD$PÍt&'UWVS|$D$ QhjPcsD$ǃD$RPWjv@tqL$ u1ۋl$U\$4PPSg PSD$PgXw'NGD$E‹t$ hh j]* hh j}ÉT$0~0ÍUWVS$u ,u RRW$P+Ĭ1[^_]PPWjĻ-P]t)Ĭ[^_]D$[D$D$ ƃT$(\5PPST$RYt*\$ \$txNxu\$ t L5;L$ t5D$u\$ uD59;D$T$%)‰T$D$ 룃}@D${ID$(<l$ 1 PYXRYD0 0=L$,D$(5Ļ^t$$VjjUj.Z =`L$AL$UWVS T$RjT$@R$D$(88 < @ t[^_]Ë\KQ8t31Ku1BÈY%\s~84St 8SBLt8 4t< t #<"\kEt;t7WWj*PUW1҅t@jj jP/\\…t{ fWDst:t6VVj*P W1҅t@jj jP[\…tK fQFS(tu&tt(ǂ&S,tu>t3t/tu tu,ǂS fzB{1ɋStt 8 uxuJ)\SB8t:t6QQj*PV1҅t@jj jPZ\…ts fVHKt:t6RRj*PU1҅t@jj jPZ…t -\] fSJD$xfJf/kfJB UUjjjjjjjjj P0 P[[=\^jjjjjjjjjw S0 P[5\_ZËNRPu U18QQUSuߡ@ @ 1t8.Fut x1ƅt SX|mtJ\@ rRRWS'UZ @ Q腠@ 9<T$0|$1uwt$OL$0tz;t$t)ހ|;tfD$D$|$0t"|$)ߊt GFuHPT$;t\1ҊT$DQt|$뵃&N뗊VT$;t \1ҊT$DQbwZwRw;t&q\0DNGT$v{[~v SkW,$aW…tt L(8Ltt GFuJOtޅtڊL*8Lt΃ P=q=(\UWVS =\l$ tPfw1ftC+vQfO")ʉ)щʋORjPUYWtC9r1 [^_]ËWH UWVS =\l$ t\fw1ftO&vifO$)ʉ)щfO"ʋOQjPUVtC9r [^_]ËW 4ZH `I븍&U1WVS \t}f{ 19sifK&fC")%)fS$ыSRjPT$,RVtF9r [^_]ËC,tt;t:\$$t׋t$$tWWUP\Z \$@RT|$D @륡@ t빋JbUWVS t$ \$$K <݄ t݀ t݄ ݀  ` A ` ԋ 11~K <݄ t݀ u끋5` F5` oGJwG1ۡ 1҅K~&X <݄ t݀  5` F5` J1ۡ 1҅K~&X <݄ t݀  5` F5`  1҅~LK <݄ t݀ 1~K <݄ t݀ 1}5` F5` ` @` 뿡 1҅~!X <݄ t݀ 5` F5` G1%tGuG?t;u߅H@GJw11ۈӋ  Մ Հ ZJQ1ۈӋ L$`u T$0BT$0t$d%\$4C\$4 9X <݄ u ݀ tƒ RF,ÃB;(v,5$(RRPV $3,PS$h9RJ,$ډ$IF  ,^` @` i 1~mK <݄ t݀ D$ ~:K <݄ t ݀ L$ 1ɅT$ 5` F5` Ӌ5` F5` G1ۊӍKσT`t%  ń ŀ XD050 t$9X <݄ u ݀ tƋ\$( VE9~؋,D;(v,$(QQPS5 $, $PVt$$VRBI$,ډ$DN` @` l 1҅~rH <ń tŀ G1%tzGunG?t";teuڅuDt&8H@뿡` @` 똡 50D$ X <݄ t ݀ T$ D$(,D;(v, $(RRPQ$7,P$\$$SVRG5$,މ4$NC` C` sG1G1ҊDQt GtZ ń 4ŀ  1҅~LK <݄ t݀ 1~K <݄ t݀  !5` F5`  ` A ` 뽋 1~ K <݄ t݀ 5` F5` C!1 h?RUWVS t$ \JD$ D$ \$(<t"$t7 WT$8t Fӄu<} 1 [^_]ÍF>V<t1Mt&1҈DQtF|EЊ .< 1* /$|$ u|$ ugfff-\)}t)p t@P=$$  :QJk)t <)څۉ<~ K-8U<=<} _p t@PX(ZPj >L$RQ (T$RQt& (RPhPQ7됐&T$LÐt&SPPP\$t tPPhSP?6XZ[à hsPtŐt&Pu=PT$R@VSSt$D$t6QQPVHÅtZ[^à VP38 t&܃ PL$; Tt)x19 Pt BvXùPDXÐt&SD$x1ҹP9Dt Bv[ËP\hRF8f:$o\t ÐSPPD$\\t5 Rk \f:Q1҅t8ZY[ SSS\$t> Su, S \91J!щ \ZY[à P跀ƐVSMbL$ ȉ)t$T$)ى)ȉ)ÍىT$ t&PPSV?4@u468u$L$T$L$ փ1[^ÐUWVS$0$8 W8=v=tE[^_]QhhQ=(W4$9;$4D\tS(;$4VVhj9ƅQQj/W21҅,ӃtO W%t?HNX^H N X^HNX^HNX ^ H$N$ V~ \YS$PhRh@ ;$D5\?f^(<$8X$@R:usSShxhthtE \Axtt EiQWhQvxtt EGRWhRT17\끃 hDu \ hD \ʋYD$s$1fy Bt8t(Bu \fA F%9|L$ Ѓ V_thPWhRZ5(Vj#jh@R9lRV\$SWLÃtfN1ftF<vfNB%9rfF 1%9s‹N뮋=\ W(R5tJ.|$&\PWhTJ(Q4x9.8t؋~~9fWL$|.8tѐWSS\\$tQQSP(R51҅t1߃Z[_Ðt& \tQL$QjP(R-1҅t -8tЃ Íptƀߍ&'\,RNu#\@0tPǂ1҉Ѓ Ít&'\hRu \1ҋAlAlЃ Í' \t"BhQPjJ(Q,t#-8t áptƀptxuuRRjPR1ǃ j pؐ \tpuGB,u%,8t Ѓ áptƀQPjJ(Q+1҅t‰ j pXZjQR>\댍vh \u&+8t Ѓ ÐptƀRhjP(RT+1҅t뽐UWVSQt$t{\$ L$\$|$t8uCFt1t3D$ T$T$ |$t 8tBuu F1uۅt;tFtلu1Z[^_]ÉSQQ \$t61Ҋ t" < |t Bv [Z[Ë  htUWVS $ $$$(t1%.u{t!.u {.u{t SQt 1 [^_]à ShRh*ST$R 1 =t/ 5DV^,YÍT$ RQ,L h+4 tD=u D 5DV,YÍT$ R+LÅt% P+^ƍT$ R+L0~7 h2StUl$UWPm U\$SWhSt$VSh-W/Y[jWl xPRRjW.Åx=PPUSIƅt S'Nj{ U 1ݍ\$SVh-W/XZjW xPPPjW-Åx=PPUSƅt S)'N Ud 1ݍ\$SVh-W/XZjW xPPPjW-Åx=VVUP]ƅt S&N U 1ݐt& D$=u!u&=u h+4u֡D ãD鐍& =D$utD À=u h+4_t؃ P_ʍv'WVS\$|$PPjS[ xEPPjS+Åx2VVWP8ƅt S%[^_à W 1t&'U1W VSP$h$dj |$8WV- t1ҁL[^_]11ɊT$1L$0сu11ҊD$5T$41ɊL$31ۍ,\$211ҊD$7T$6l$,,1D$91T$8l$(,1D$;1T$:l$$,D$ |$$X Po$tA:vPSWV-D$,9\$tL$)ȍ9QPjR+D0QQj!ځ t€u҃)QRp$t1҃RRWP,|$QQjD$8,},Po$tB_RL$0QPV3,;D$,E\$,+RRjD$4'}'Pwo$tE  Pl$,UWV+9$d1;L$(Z }/O DOfKA;L$(|PPjD$0=}Pn$t1҃A\$$,$dD$ fC,fC'fC =Hum\$,+$dx;C+~\$(&$dE fXC&~\$$$diDC~Qj WV* u11L$1D$01ҊT$4D$ 1ɊL$31D$2,1D$5 1D$71T$6L$ 1D$91T$8T$D$DЉD$=B6|$($dE'S,fAfQD$fA PPRQR $tBXYfJQB P$tA XZfQ RQR$tfۉBfZ"f틜$dfk$wl$uL$t"Pl$\$UWV4)19HD$$dt$ffq&ufl$PPjT$Rel$t1҃A q\$\$T$Rl$$UL$$QP\$44_V | YSt$$VT$,RD$ttT$$9w 8t@9vC9|[^_]9vT$$Љ뾉u@t mSYuQQj j5ZCt"ÉŊFSt fC fC]9t& RRj jYʼnu뾐SPP\$,HtaPSjT$RH@tD$1ɍPt!hh_SS٤[^_]Í&'UWVS\DžE] DžDžtU:u8MWQSjx]@e[^_]à }W` Stċ5Džu Dž=tt  V5 ƅ{X8 t~ U<.t<\~.uPQWV Hu W~ @$ UÍt$… Ш YW; @PSW G 1ҍt$f jTCDžaPh h_SqVUʼnQPSjh @ SL ZEP< |<$SuXV @$Sƅ Ȩ5Dž?.AM<.4<\y.MPQjRB ÍWjPBC@Dž.\x8.uzH.ujHuc 4VR?1C;B;r㋵1u~8.uʋ.tÃ\DžDž S u1h1Rhh_SPiQhh_SRǟFz.PUG<.B8z.~MPPQV+ 11҅t/t)<\%P01A|t tuQQSW(9/XZT9VR SWj x>Phh_SWݞD$p$2Phh_SW蟞 hh_SV茞z.?t&UWVS։D$PDžu$'|[^_]Ël$ |/%D$1@u SOD$1L$t1 \$E R D8$O QQT$RPW L$t8/PPPL$R0 $tL$RQRjpD$ %=@\ Py /D<1ۅl$RUPj:uD$ %=@tiCu|$1ۅtPhdh_S CQ趜,uPheh_SV蛜D$|[^_]Ã|1[^_]à \1D$t9D$LD$xuBt$L1ۊFt$L9D$xڋ(D]t сD$x`DZY]8949u;\$Ht$tC9t$L\$H D$P19D$H#D$xt L$H9/\[^_]9밅tL$x/u؋T$x.Át|$T9|$HttL$Hy/f럋l$P9l$H بut$x.t#T$T9T$H_D$xtD$Hx/J\$LL$/D$xt*[T$/֋(Dut /8T$/t$L(;t$tF?* Ȩtd/T$x?Å\$Dt >(?u\$HT$PC1\$H9T$Hs|$H`;t$tg|$x\tD$xt&ځ׋Dxt zNt$t$P9t$HIL$x߉ΉL$0\$HD$x?L$H1ۊDZ9.n1Ft.tGD|]u  MÉL$ tyD$ 9uPWUSuߋu؋Ft$xtD$x\$xt_\$(;$h?* Ȩt{/%$S?…T$\t >(?u1T$h\$p1T$h9\$hpL$h9ePPL$8Qt$HV[8;$\L$Ht$~t$p9t$h$ƉD$D/$uD$h9t#L$hD$pL$h9D$hm[…uD$Dt (tRRRhadP$R$QW$D$xu1\$hT$p9s/$Rڋ$PVL$|QWtǃ;\$prD$TD$XD$PD$L^F;$ [t9 (Kˋă]K|tˋ뭋t$TusK!L$Lƒ^ Шt\$LˋD$Tq D$tQq L$tR9^1ƅI$=s:. Ȩu K=;Kt$P/K)#D$TKT$Xt$XJT$X뉍T$TKt$Pt D$P9C K;\$L\$TKD$L\$Tt?ƒ* 1Ҩ  S& S[$D$h9/tT$TK/t$XFt$X9\$h0v$P苌$QV|$|W=;\$prͺ?ˋD$P D$tQN T$t Q9; UWVS t$ |$$l$(… Шt [^_]à W/4$$l$8t$0 ډL$4[^_]='UWVS |$ t$$l$( HtEPWjL$QwmÅ بv [^_]Í… кuۃ V<$0 UPWPVjT$Rqvst$|$… ШUhhd|$W` hhdt$V`؃ [^_]à V <$0\Phzhd\$S` Ȩ V<$0 Wx4$m ڍ UQV4UWVSt$<\$0l$4 URQDžD$T$89T$s^ V9tjU<\uI\JE)ЋttED$@D$T$89T$rD$[^_]VWRS/VWEPu"E뜃 Q]l$ \$D$VD$ T$$UWL$$Q|$$WËt$V؃JBv'UWVS,\$HL$@… ШD$ D$$D$ hXŅ h<D$(D$uft&D$D$ \$ D$@D$|$9|$T$D$|$ DD$\$t |$,W.tot<\u D$\냍D$ PjVL$(QaD$\$ r UXT$$RD$P,[^_]ÍT$ R룋T$ T$PP|$WU>ÅPPWL$$Q"T$D$D$|$ DD$\$t t$@.l$Dt(L$DD$,H[^_]Ë\$@,[^_]à l$$Ũ UZ|$$W\$P St$@뫃 UUWVS,T$D$ue= j} ˣQ!)@ ; @wD$9| ;@C~1,[^_]Ë j ˣQ!)i˅g Sƒ1t؋-݉-ڃ~#RЍP BTIB@ ~9Cxuƃx;~=D$u jf$l$ V蟿,$ UVjkD$,@}K ~9~3xtI<uA9xtAt99 Ш[@1Ƌz<9t$ tML$ 9qtD (jhhfQ{(XR jjhXfD$9T$ OJT^<~4uh9 Љƃ Wpƒt<  tN<*zNTZBl$ƅPƃx8T$@SD$(PhfR]X-(U耿 $DWL$QhffFUUl$nl$|$L$>KD$C T$S L$K ^D$t@|$ w"D$1ɉڃv Iw$9MɉUtE܉EEEUMHEU0^_É;}vUM̉UMEUEU0^_ǃEua9}w9urŰE)E܉ŰUtE܋ỦEUMEUQ녅u 1ƋẺE܉U= +EԉE؉MMM׊M؋U E̊ME̊M؋E ẺE̊MUe;ỦEw uE9Ev M)MȋEM̋E+EщM̉ʊMMԉE ‹EUEUWVS [ FȤȤE)19sE)F9r [^_]UWVS[ý ȤȤ)Nu. [^_]ÐUSR$$ vЋuX[US[[PY[debuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfile~/.bashrcrbashBASH_ENVrun_wordexp%u %u --wordexp0 0run_one_command-cshell.cI have no name!??host??GNU long options: --%s Shell options: -%s or -o option i386-root-linux-gnuGNU bash, version %s-(%s) %c%c: invalid optionPOSIXLY_CORRECT\s-\v\$ > PS1PS2POSIX_PEDANTIC/etc/profile~/.bash_profile~/.bash_login~/.profileEMACS*term*FUNCNAMEBASH_SOURCEBASH_LINENOmaindumbemacs%s: invalid option%s: is a directoryUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. /usr/local/lib/bashdb/bashdb-main.inc%s: option requires an argument%s: cannot execute binary fileSBtimed out waiting for input: auto-logoutPROMPT_COMMAND/%s etermTMOUTreader_loop-p&&||>><&>&;;<<-<<<&>>|thenelseeliffiesacforselectwhileuntil[[readline stdin%s.%dHOME%a %b %d%H:%M:%S%I:%M:%S%H:%M%I:%M %p ; syntax error near `%s'syntax error ;|&-nexpected `)'"$@"Use "%s" to leave the shell. PIPESTATUS, a!"#$%&'()*+,-45rsdn6.t12"g@h^TI66667788888888888888888888888888888999::;;<<<<===========>>>>>>>>????@@@@@@AAABBBCCDEEEFGHIIIJJKKKKLLMMNOOPPPQQQQQQRRSSSTTUUUVVVVVWWWWWWXXYY  yyy$%Yyy&)+,/930.54678{iyyyy !"$*'-tuyy|}ywvxyzhjsyyyyyyyZy  # XT(yyyyyyyyyyyRQ~yyUlmk^yyyyDEyyyy12SOWnopqrNd_Lf:y;FyGPVyyyyeMy<=yyBCHI[yg`ayyyyy]bc@A\>?JK;<`?0z/OSPT3\]uw7|bc:qxQUqo=A >qklmqByq8M9qqNiq00RVqq%& WqXYqZ`[p00v{ef}klmghef00~klm^  !"'     # $(*-)._+ j@ klm q   q CDEFGHIJKL# 9 , 78:,-=,11,24 @,a+,-4,42ef2i,.2,,5v224z{.j,pghh2xy,,}~22,,221+1.+45+,-*+5+,- !"#$&'()/0 !"#$&'()335/05  *+,%33%3 333 !"#$3&'(),-/0!24 3  !"#$&'()+,-/024  !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0,*451+0/2.3  !"#$%&'()-7  )8HY\foqu|4=hsxr4ep4*=)4hh4"I)4hhhhhh) $ Jt Z_hhhhh !1<4{{{{{{{{{{{{{{{{{{{{FF{{({{{{{{{{{{{{{{F{ {{{YLY{{{L{{FL{{{r{{ {{{LqF Mdd6O>d$ddccccbc?c cbbbqbOb.b baaaaQaa````e`C`"``_____m_P_1__ _^^^^^^u^h^[^N^A^4^'^]]/]\\7\[[[P[[ZZ?ZYYFYM YXXlXDXXXWWWWgWMW4W&W WVVMVVVUUMUUdVVMUMtUMTU4U UTTTMMTTwTMM#TS[ST;SSRRRRRRoRRQQQQ/Users/chet/src/bash/src/parse.yunexpected EOF while looking for matching `%c'syntax error near unexpected token `%s'syntax error: unexpected end of fileunexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'unexpected EOF while looking for matching `)'syntax error in conditional expressionunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token `%s', expected `)'unexpected token %d in conditional commandunexpected argument `%s' to conditional unary operatorunexpected argument `%s' to conditional binary operatorunexpected argument to conditional unary operatorunexpected argument to conditional binary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedgetcwd: cannot access parent directories`%s': not a valid identifier/dev/ttygeneral.cOLDPWD=~:~make_cmd.csyntax error: `((%s))'syntax error: `;' unexpectedclean_simple_commandsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dmake_redirection: redirection instruction `%d' out of rangeAA0AДДPS4print_cmd.c%s=(%s) ''%sfor %s in select %s in case %s in [[ ]] ! ''(( )) %u<<< %s<<%s%s >>%s<%s%d>&%s-%d<&%s-%d>&%d-%d<&%d-%d>&%s%d<&%s>|%s<>%s%d>&-%d>&%d%d<&%d ) && || case %s in time -p print_commandfunction %s () { } do { for (( | if then else %c() cprintf: `%c': invalid format characterprint_command: bad connector `%d'ۢi 'dƣucQ=)"OyhʬviEdispose_cmd.cdispose_command                 +?XtFrrrr[r[rrrrrrrexecute_cmd.cexecute_cond_nodeeval_builtinbuiltin_envreturn_temp_env%s: %s: bad interpretersimple-commandauto_resumebgfgsubstring%s: command not foundsaved redirects/dev/nullsaved_redirectsexactreal %2R user %2U sys %2Sexecute_commandloop_redirections real %3lR user %3lU sys %3lS%s: readonly functionfunction_callingexecute-shell-functionPS3LINESCOLUMNS%*d%s%s#? execute_connectionpipe-file-descriptorspipe errorcannot duplicate fd %d to fd %d%s: restricted: cannot specify `/' in command namescannot redirect standard input from /dev/null: %sTIMEFORMAT: `%c': invalid format character++++++++++ffff~f~~fffffxa5`GGLOBIGNOREHISTCONTROLHISTFILESIZEHISTIGNOREHISTSIZEHISTTIMEFORMATHOSTFILEIFSIGNOREEOFLANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICMAILMAILCHECKMAILPATHOPTERROPTINDTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistcharsignoreeofvariables.c%s=PPIDshell-initSHLVLSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSBASH_ARGCBASH_ARGV_=HISTFILEignorespaceerasedupsignoredupsignoreboth+ i386HOSTTYPEOSTYPEMACHTYPEHOSTNAME60060BASHBASH_VERSIONBASH_VERSINFO~/.sh_history~/.bash_history500EUIDBASH_EXECUTION_STRING() {make_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1all_local_variables: no function context at current scopepop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scope/usr/gnu/bin:/usr/local/bin:/bin:/usr/bin:.error importing function definition for `%s'copy_cmd.cМММММEEEEE```EEEEE``EE8eܠ>emӥɦɦɦɦɦɦɦɦɦɦɦɦbash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jumpAborting...last command: %s (null)%s: line %s: warning: %s: %s:%s%d: %s: %s: %d%s: unbound variable%s: readonly variableexpr.crecursion stack underflowsyntax error in expressioninvalid arithmetic basevalue too great for base*/%+-&^|missing `)'division by 0exponent less than 0bug: bad expassign tokenexpression expected%s%s%s: %s (error token is "%s")expression recursion level exceededidentifier expected after pre-increment or pre-decrementsyntax error: operand expectedattempted assignment to non-variable`:' expected for conditional expressionflags.cjobs.c[%d] %ld |Stopped%*s (wd: %s)%5ldRunningDone(%d) (core dumped) &DoneSignal %dStopped(%s)Exit %d[%d]%c [%ld: %d] tcsetattrnotify_of_job_status%s: line %d: (wd now: %s) (core dumped)SIGCHLD trapforkchild setpgid (%ld to %ld)job-working-directoryno job control in this shell (wd: %s)%s: job has terminateddescribe_pid: %ld: no such piddeleting stopped job %d with process group %ldinitialize_job_control: setpgidinitialize_job_control: getpgrp failedwait_for: No record of process %ld%s: job %d already in backgroundwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shellsubst.c$($[command substitution%s: parameter null or not set#%:-=?+/}%:=+/%s: bad substitution%s: substring expression < 0<(>(process substitutionno match: %sSRRRRRRRRRSRRRRRRRRRRRRRRRRRRRSSRRRRRRRRRRRRRRRRRRRRRRRRRRSSSVSVSVSVSVSVSVSVSdSSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSSSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSVSSSXXnXNGkkkkkkkkykkkkkkkkkkkkkkkkkkk-kkkkkkkkkkkkkkkkkkkkkkkkkk=ъ}qъъъъъъъъeъъъъъъъъъъъъъъъъъYɯJ޳Qbad substitution: no closing `%s' in %s%s: cannot assign list to array membercommand_substitute: cannot duplicate pipe as fd 1cannot make child for command substitutioncannot make pipe for command substitution$%s: cannot assign in this waycannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dhashcmd.chashlib.cmailcheck.cThe mail in %s has been read You have mail in $_You have new mail in $_EXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGJUNK(16)SIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGJUNK(34)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNinvalid signal numberSIGtrap.cexit trapinterrupt traptrap_handler: bad signal %ddebug traperror trapreturn traprun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfinput.csave_bash_input: buffer already exists for new fd %dcannot allocate new file descriptor for bash input from fd %dunwind_prot.cpathexp.c' ( ( ( ( ( ( ( ( ' ' ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ' ' ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ' ' ' /dev/fd/%s: binary operator expectedargument expected`)' expected, found %s%s: unary operator expected`)' expectedmissing `]'too many arguments6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6  7 %7 R7 7 6 "@ < < < < u@ < ? ? < < < ? < < < < < < < < < < < < < > ]? +? > > @ @ u@ < < N@ < < AA %A > < f> /> = = < |= "= < = #B B B B B #B B #B #B B B B #B B B B B B B B B B B B B B #B #B #B #B #B #B #B #B B B #B B B #B #B #B B #B #B #B #B B #B #B B #B E D D D D E D E E D D D E D D D D D D D D D D D D D E E E E E E E E D D E D D E E E D E E E E D E E D E  I H H H H  I H  I  I H H H  I H H H H H H H H H H H H H  I  I  I  I  I  I  I  I H H  I H H  I  I  I H  I  I  I  I H  I  I H  I yK K K K 0K L yL yL yL yL L yL L L yL yL yL L yL yL yL yL yL yL yL yL yL yL yL yL yL L L L L L L L L yL yL L yL yL L L L yL L L L L yL L L yL L %s: integer expression expected@(#)Bash version 3.00.16(1) release GNUCopyright (C) 2004 Free Software Foundation, Inc.release3.00%s.%d(%d)%s.%d(%d)-%sGNU bash, version %s (%s) alias.c ;|&( ;|&()array.cbad array subscriptarrayfunc.c'()'%s[%s: %s[%s]: %sarray assign%s: cannot assign to non-numeric indexbraces.cbracecomp.c%s: cannot create: %sbashhist.c%s%s%sFIGNORE "'><=;|&(: "'@><=;|&(:#comment-begin$@bashline.cshell-expand-lineBashhistory-expand-linemagic-spacehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{$include hostname_completion_file/etc/hosts%s %dC-xC-e;|&{(`()<>;&| symlink-hook "'bash_execute_unix_commandno closing `%c' in %s%s: missing colon separatorfc -e "${VISUAL:-${EDITOR:-vi}}"fc -e "${VISUAL:-${EDITOR:-emacs}}"bash_execute_unix_command: cannot find keymap for command%s: first non-whitespace character is not `"'stringlib.clocale.cPOSIX"" #: %s:%d msgid %s%s msgstr "" findcmd.c/dev/tcp/*/*/dev/udp/*/*file descriptor out of rangeredir.c%s: ambiguous redirectsh-thd%s: restricted: cannot redirect output%s: cannot overwrite existing filecannot create temp file for here document: %sredirection error: cannot duplicate fd                       c c   c %    ` `   $% C% C% $% C% C% 3% $% C% 3% $% C% $% 3% $% pcomplete.cCOMP_LINECOMP_POINTCOMP_WORDSCOMP_CWORDCOMPREPLYcompletion: function `%s' not foundpcomplib.cprogcomp_insert: %s: NULL COMPSPECxmalloc: cannot allocate %lu bytes (%lu bytes allocated)xrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: %s:%d: cannot allocate %lu bytes (%lu bytes allocated)xrealloc: %s:%d: cannot reallocate %lu bytes (%lu bytes allocated)Display the possible completions depending on the options. Intendedto be used from within a shell function generating possible completions.If the optional WORD argument is supplied, matches against WORD areFor each NAME, specify how arguments are to be completed.If the -p option is supplied, or if no options are supplied, existingcompletion specifications are printed in a way that allows them to bereused as input. The -r option removes a completion specification foreach NAME, or, if no NAMEs are supplied, all completion specifications.printf formats and prints ARGUMENTS under control of the FORMAT. FORMATis a character string which contains three types of objects: plaincharacters, which are simply copied to standard output, character escapesequences which are converted and copied to the standard output, andformat specifications, each of which causes printing of the next successiveargument. In addition to the standard printf(1) formats, %b means toexpand backslash escape sequences in the corresponding argument, and %qmeans to quote the argument in a way that can be reused as shell input.Toggle the values of variables controlling optional behavior.The -s flag means to enable (set) each OPTNAME; the -u flagunsets each OPTNAME. The -q flag suppresses output; the exitstatus indicates whether each OPTNAME is set or unset. The -ooption restricts the OPTNAMEs to those defined for use with`set -o'. With no options, or with the -p option, a list of allsettable options is displayed, with an indication of whether orDisplay the list of currently remembered directories. Directoriesfind their way onto the list with the `pushd' command; you can getback up through the list with the `popd' command.The -l flag specifies that `dirs' should not print shorthand versionsof directories which are relative to your home directory. This meansthat `~/bin' might be displayed as `/homes/bfox/bin'. The -v flagcauses `dirs' to print the directory stack with one entry per line,prepending the directory name with its position in the stack. The -pflag does the same thing, but the stack position is not prepended.The -c flag clears the directory stack by deleting all of the elements.+N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero.-N displays the Nth entry counting from the right of the list shown byRemoves entries from the directory stack. With no arguments,removes the top directory from the stack, and cd's to the new+N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second.-N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last.-n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated.You can see the directory stack with the `dirs' command.Adds a directory to the top of the directory stack, or rotatesthe stack, making the new top of the stack the current workingdirectory. With no arguments, exchanges the top two directories.+N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with-N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with-n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated.dir adds DIR to the directory stack at the top, making it the new current working directory.BASH_VERSION Version information for this Bash.CDPATH A colon separated list of directories to search when the argument to `cd' is not found in the currentGLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion.HISTFILE The name of the file where your command history is stored.HISTFILESIZE The maximum number of lines this file can contain.HISTSIZE The maximum number of history lines that a runningHOME The complete pathname to your login directory.HOSTNAME The name of the current host.HOSTTYPE The type of CPU this version of Bash is running under.IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input.MACHTYPE A string describing the current system Bash is running on.MAILCHECK How often, in seconds, Bash checks for new mail.MAILPATH A colon-separated list of filenames which Bash checksOSTYPE The version of Unix this version of Bash is running on.PATH A colon-separated list of directories to search whenPROMPT_COMMAND A command to be executed before the printing of eachPS1 The primary prompt string.PS2 The secondary prompt string.PWD The full pathname of the current directory.SHELLOPTS A colon-separated list of enabled shell options.TERM The name of the current terminal type.TIMEFORMAT The output format for timing statistics displayed by theauto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job.histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'.HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list.Returns a status of 0 or 1 depending on the evaluation of the conditionalexpression EXPRESSION. Expressions are composed of the same primaries usedby the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else falseWhen the `==' and `!=' operators are used, the string to the right of theoperator is used as a pattern and pattern matching is performed. The&& and || operators do not evaluate EXPR2 if EXPR1 is sufficient todetermine the expression's value.The EXPRESSION is evaluated according to the rules for arithmeticevaluation. Equivalent to "let EXPRESSION".This is similar to the `fg' command. Resume a stopped or backgroundjob. If you specifiy DIGITS, then that job is used. If you specifyWORD, then the job whose name begins with WORD is used. Following thejob specification with a `&' places the job in the background.Run a set of commands in a group. This is one way to redirect anCreate a simple command invoked by NAME which runs COMMANDS.Arguments on the command line along with NAME are passed to theExpand and execute COMMANDS as long as the final command in the`until' COMMANDS has an exit status which is not zero.`while' COMMANDS has an exit status of zero.The if COMMANDS are executed. If the exit status is zero, then the thenCOMMANDS are executed. Otherwise, each of the elif COMMANDS are executedin turn, and if the exit status is zero, the corresponding then COMMANDSare executed and the if command completes. Otherwise, the else COMMANDSare executed, if present. The exit status is the exit status of the lastcommand executed, or zero if no condition tested true.Selectively execute COMMANDS based upon WORD matching PATTERN. The`|' is used to separate multiple patterns.Execute PIPELINE and print a summary of the real time, user CPU time,and system CPU time spent executing PIPELINE when it terminates.The return status is the return status of PIPELINE. The `-p' optionprints the timing summary in a slightly different format. This usesthe value of the TIMEFORMAT variable as the output format.The WORDS are expanded, generating a list of words. Theset of expanded words is printed on the standard error, eachpreceded by a number. If `in WORDS' is not present, `in "$@"'is assumed. The PS3 prompt is then displayed and a line readfrom the standard input. If the line consists of the numbercorresponding to one of the displayed words, then NAME is setto that word. If the line is empty, WORDS and the prompt areredisplayed. If EOF is read, the command completes. Any othervalue read causes NAME to be set to null. The line read is savedin the variable REPLY. COMMANDS are executed after each selectionuntil a break command is executed.EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression isomitted, it behaves as if it evaluates to 1.The `for' loop executes a sequence of commands for each member in alist of items. If `in WORDS ...;' is not present, then `in "$@"' isassumed. For each element in WORDS, NAME is set to that element, andWait for the specified process and report its termination status. IfN is not given, all currently active child processes are waited for,and the return code is zero. N may be a process ID or a jobspecification; if a job spec is given, all processes in the job'sThe user file-creation mask is set to MODE. If MODE is omitted, or if`-S' is supplied, the current value of the mask is printed. The `-S'option makes the output symbolic; otherwise an octal number is output.If `-p' is supplied, and MODE is omitted, the output is in a formthat may be used as input. If MODE begins with a digit, it isinterpreted as an octal number, otherwise it is a symbolic mode stringlike that accepted by chmod(1).Ulimit provides control over the resources available to processesstarted by the shell, on systems that allow such control. If anoption is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -f the maximum size of files created by the shell -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memoryIf LIMIT is given, it is the new value of the specified resource;the special LIMIT values `soft', `hard', and `unlimited' stand forthe current soft limit, the current hard limit, and no limit, respectively.Otherwise, the current value of the specified resource is printed.If no option is given, then -f is assumed. Values are in 1024-byteincrements, except for -t, which is in seconds, -p, which is inincrements of 512 bytes, and -u, which is an unscaled number ofFor each NAME, indicate how it would be interpreted if used as aIf the -t option is used, `type' outputs a single word which is one of`alias', `keyword', `function', `builtin', `file' or `', if NAME is analias, shell reserved word, shell function, shell builtin, disk file,If the -p flag is used, `type' either returns the name of the diskfile that would be executed, or nothing if `type -t NAME' would notIf the -a flag is used, `type' displays all of the places that containan executable named `file'. This includes aliases, builtins, andfunctions, if and only if the -p flag is not also used.The -f flag suppresses shell function lookup.The -P flag forces a PATH search for each NAME, even if it is an alias,builtin, or function, and returns the name of the disk file that wouldThe command ARG is to be read and executed when the shell receivessignal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPECis supplied) or `-', each specified signal is reset to its originalvalue. If ARG is the null string each SIGNAL_SPEC is ignored by theshell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0)the command ARG is executed on exit from the shell. If a SIGNAL_SPECis DEBUG, ARG is executed after every simple command. If the`-p' optionis supplied then the trap commands associated with each SIGNAL_SPEC aredisplayed. If no arguments are supplied or if only `-p' is given, trapprints the list of commands associated with each signal. Each SIGNAL_SPECis either a signal name in or a signal number. Signal namesare case insensitive and the SIG prefix is optional. `trap -l' printsa list of signal names and their corresponding numbers. Note that asignal can be sent to the shell with "kill -signal $$".Print the accumulated user and system times for processes run fromThis is a synonym for the "test" builtin, but the lastargument must be a literal `]', to match the opening `['.Exits with a status of 0 (true) or 1 (false) depending onthe evaluation of EXPR. Expressions may be unary or binary. Unaryexpressions are often used to examine the status of a file. Thereare string operators as well, and numeric comparison operators. -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. -z STRING True if string is empty. STRING True if string is not empty. True if the strings are equal. True if the strings are not equal. True if STRING1 sorts before STRING2 lexicographically. True if STRING1 sorts after STRING2 lexicographically. -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge.Arithmetic binary operators return true if ARG1 is equal, not-equal,less-than, less-than-or-equal, greater-than, or greater-than-or-equalSuspend the execution of this shell until it receives a SIGCONTsignal. The `-f' if specified says not to complain about thisbeing a login shell if it is; just suspend anyway.Read and execute commands from FILENAME and return. The pathnamesin $PATH are used to find the directory containing FILENAME. If anyARGUMENTS are supplied, they become the positional parameters whenThe positional parameters from $N+1 ... are renamed to $1 ... If N isnot given, it is assumed to be 1.The given NAMEs are marked readonly and the values of these NAMEs maynot be changed by subsequent assignment. If the -f option is given,then functions corresponding to the NAMEs are so marked. If noarguments are given, or if `-p' is given, a list of all readonly namesis printed. The `-a' option means to treat each NAME asan array variable. An argument of `--' disables further optionNAMEs are marked for automatic export to the environment ofsubsequently executed commands. If the -f option is given,the NAMEs refer to functions. If no NAMEs are given, or if `-p'is given, a list of all names that are exported in this shell isprinted. An argument of `-n' says to remove the export propertyfrom subsequent NAMEs. An argument of `--' disables further optionFor each NAME, remove the corresponding variable or function. Giventhe `-v', unset will only act on variables. Given the `-f' flag,unset will only act on functions. With neither flag, unset firsttries to unset a variable, and if that fails, then tries to unset afunction. Some variables cannot be unset; also see readonly. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions.Using + rather than - causes these flags to be turned off. Theflags can also be used upon invocation of the shell. The currentset of flags may be found in $-. The remaining n ARGs are positionalparameters and are assigned, in order, to $1, $2, .. $n. If noARGs are given, all shell variables are printed.Causes a function to exit with the return value specified by N. If Nis omitted, the return status is that of the last command.One line is read from the standard input, or from file descriptor FD if the-u option is supplied, and the first word is assigned to the first NAME,the second word to the second NAME, and so on, with leftover words assignedto the last NAME. Only the characters found in $IFS are recognized as worddelimiters. If no NAMEs are supplied, the line read is stored in the REPLYvariable. If the -r option is given, this signifies `raw' input, andbackslash escaping is disabled. The -d option causes read to continueuntil the first character of DELIM is read, rather than newline. If the -poption is supplied, the string PROMPT is output without a trailing newlinebefore attempting to read. If -a is supplied, the words read are assignedto sequential indices of ARRAY, starting at zero. If -e is supplied andthe shell is interactive, readline is used to obtain the line. If -n issupplied with a non-zero NCHARS argument, read returns after NCHARScharacters have been read. The -s option causes input coming from aThe -t option causes read to time out and return failure if a complete lineof input is not read within TIMEOUT seconds. If the TMOUT variable is set,its value is the default timeout. The return code is zero, unless end-of-fileis encountered, read times out, or an invalid file descriptor is supplied asEach ARG is an arithmetic expression to be evaluated. Evaluationis done in fixed-width integers with no check for overflow, thoughdivision by 0 is trapped and flagged as an error. The followinglist of operators is grouped into levels of equal-precedence operators.The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement !, ~ logical and bitwise negation *, /, % multiplication, division, remainder <<, >> left and right bitwise shiftsShell variables are allowed as operands. The name of the variableis replaced by its value (coerced to a fixed-width integer) withinan expression. The variable need not have its integer attributeturned on to be used in an expression.Operators are evaluated in order of precedence. Sub-expressions inparentheses are evaluated first and may override the precedenceIf the last ARG evaluates to 0, let returns 1; 0 is returnedSend the processes named by PID (or JOB) the signal SIGSPEC. IfSIGSPEC is not present, then SIGTERM is assumed. An argument of `-l'lists the signal names; if arguments follow `-l' they are assumed tobe signal numbers for which names should be listed. Kill is a shellbuiltin for two reasons: it allows job IDs to be used instead ofprocess IDs, and, if you have reached the limit on processes thatyou can create, you don't have to start a process to kill another one.By default, removes each JOBSPEC argument from the table of active jobs.If the -h option is given, the job is not removed from the table, but ismarked so that SIGHUP is not sent to the job if the shell receives aSIGHUP. The -a option, when JOBSPEC is not supplied, means to remove alljobs from the job table; the -r option means to remove only running jobs.Lists the active jobs. The -l option lists process id's in additionto the normal information; the -p option lists process id's only.If -n is given, only processes that have changed status since the lastnotification are printed. JOBSPEC restricts output to that job. The-r and -s options restrict output to running and stopped jobs only,respectively. Without options, the status of all active jobs isprinted. If -x is given, COMMAND is run after all job specificationsthat appear in ARGS have been replaced with the process ID of that job'sDisplay the history list with line numbers. Lines listed withwith a `*' have been modified. Argument of N says to list onlythe last N lines. The `-c' option causes the history list to becleared by deleting all of the entries. The `-d' option deletesthe history entry at offset OFFSET. The `-w' option writes out thecurrent history to the history file; `-r' means to read the file andappend the contents to the history list instead. `-a' meansto append history lines from this session to the history file.Argument `-n' means to read all history lines not already readfrom the history file and append them to the history list.If FILENAME is given, then that is used as the history file elseif $HISTFILE has a value, that is used, else ~/.bash_history.If the -s option is supplied, the non-option ARGs are appended tothe history list as a single entry. The -p option means to performhistory expansion on each ARG and display the result, without storingIf the $HISTTIMEFORMAT variable is set and not null, its value is usedas a format string for strftime(3) to print the time stamp associatedwith each displayed history entry. No time stamps are printed otherwise.Display helpful information about builtin commands. If PATTERN isspecified, gives detailed help on all commands matching PATTERN,otherwise a list of the builtins is printed. The -s optionrestricts the output for each builtin command matching PATTERN toFor each NAME, the full pathname of the command is determined andremembered. If the -p option is supplied, PATHNAME is used as thefull pathname of NAME, and no path search is performed. The -roption causes the shell to forget all remembered locations. The -doption causes the shell to forget the remembered location of each NAME.If the -t option is supplied the full pathname to which each NAMEcorresponds is printed. If multiple NAME arguments are supplied with-t, the NAME is printed before the hashed full pathname. The -l optioncauses output to be displayed in a format that may be reused as input.If no arguments are given, information about remembered commands is displayed.Place JOB_SPEC in the background, as if it had been started with`&'. If JOB_SPEC is not present, the shell's notion of the currentPlace JOB_SPEC in the foreground, and make it the current job. IfJOB_SPEC is not present, the shell's notion of the current job isfc is used to list or edit and re-execute commands from the history list.FIRST and LAST can be numbers specifying the range, or FIRST can be astring, which means the most recent command beginning with that -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first).With the `fc -s [pat=rep ...] [command]' format, the command isre-executed after the substitution OLD=NEW is performed.A useful alias to use with this is r='fc -s', so that typing `r cc'runs the last command beginning with `cc' and typing `r' re-executesExit the shell with a status of N. If N is omitted, the exit statusis that of the last command executed.Exec FILE, replacing this shell with the specified program.If FILE is not specified, the redirections take effect in thisshell. If the first argument is `-l', then place a dash in thezeroth arg passed to FILE, as login does. If the `-c' optionis supplied, FILE is executed with a null environment. The `-a'option means to make set argv[0] of the executed process to NAME.If the file cannot be executed and the shell is not interactive,then the shell exits, unless the shell option `execfail' is set.Getopts is used by shell procedures to parse positional parameters.OPTSTRING contains the option letters to be recognized; if a letteris followed by a colon, the option is expected to have an argument,which should be separated from it by white space.Each time it is invoked, getopts will place the next option in theshell variable $name, initializing name if it does not exist, andthe index of the next argument to be processed into the shellvariable OPTIND. OPTIND is initialized to 1 each time the shell ora shell script is invoked. When an option requires an argument,getopts places that argument into the shell variable OPTARG.getopts reports errors in one of two ways. If the first characterof OPTSTRING is a colon, getopts uses silent error reporting. Inthis mode, no error messages are printed. If an invalid option isseen, getopts places the option character found into OPTARG. If arequired argument is not found, getopts places a ':' into NAME andsets OPTARG to the option character found. If getopts is not insilent mode, and an invalid option is seen, getopts places '?' intoNAME and unsets OPTARG. If a required argument is not found, a '?'is placed in NAME, OPTARG is unset, and a diagnostic message isIf the shell variable OPTERR has the value 0, getopts disables theprinting of error messages, even if the first character ofOPTSTRING is not a colon. OPTERR has the value 1 by default.Getopts normally parses the positional parameters ($0 - $9), but ifmore arguments are given, they are parsed instead.Read ARGs as input to the shell and execute the resulting command(s).Enable and disable builtin shell commands. This allowsyou to use a disk command which has the same name as a shellbuiltin without specifying a full pathname. If -n is used, theNAMEs become disabled; otherwise NAMEs are enabled. For example,to use the `test' found in $PATH instead of the shell builtinversion, type `enable -n test'. On systems supporting dynamicloading, the -f option may be used to load new builtins from theshared object FILENAME. The -d option will delete a builtinpreviously loaded with -f. If no non-option names are given, orthe -p option is supplied, a list of builtins is printed. The-a option means to print every builtin with an indication of whetheror not it is enabled. The -s option restricts the output to the POSIX.2`special' builtins. The -n option displays a list of all disabled builtins.Output the ARGs. If -n is specified, the trailing newline issuppressed. If the -e option is given, interpretation of thefollowing backslash-escaped characters is turned on: \num the character whose ASCII code is NUM (octal).You can explicitly turn off the interpretation of the above charactersCreate a local variable called NAME, and give it VALUE. LOCALcan only be used within a function; it makes the variable NAMEhave a visible scope restricted to that function and its children.Declare variables and/or give them attributes. If no NAMEs aregiven, then display the values of variables instead. The -p optionwill display the attributes and values of each NAME. -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names (and line number and source file name if debugging) without definitions -i to make NAMEs have the `integer' attribute -t to make NAMEs have the `trace' attributeVariables with the integer attribute have arithmetic evaluation (see`let') done when the variable is assigned to.When displaying values of variables, -f displays a function's nameand definition. The -F option restricts the display to functionUsing `+' instead of `-' turns off the given attribute instead. Whenused in a function, makes NAMEs local, as with the `local' command.Runs COMMAND with ARGS ignoring shell functions. If you have a shellfunction called `ls', and you wish to call the command `ls', you cansay "command ls". If the -p option is given, a default value is usedfor PATH that is guaranteed to find all of the standard utilities. Ifthe -V or -v option is given, a string is printed describing COMMAND.The -V option produces a more verbose description.Return an unsuccessful result.No effect; the command does nothing. A zero exit code is returned.Print the current working directory. With the -P option, pwd printsthe physical directory, without any symbolic links; the -L optionmakes pwd follow symbolic links.Change the current directory to DIR. The variable $HOME is thedefault DIR. The variable CDPATH defines the search path forthe directory containing DIR. Alternative directory names in CDPATHare separated by a colon (:). A null directory name is the same asthe current directory, i.e. `.'. If DIR begins with a slash (/),then CDPATH is not used. If the directory is not found, and theshell option `cdable_vars' is set, then try the word as a variablename. If that variable has a value, then cd to the value of thatvariable. The -P option says to use the physical directory structureinstead of following symbolic links; the -L option forces symbolic linksReturns the context of the current subroutine call.Without EXPR, returns returns "$line $filename". With EXPR,returns "$line $subroutine $filename"; this extra informationcan be used used to provide a stack trace.The value of EXPR indicates how many call frames to go back before thecurrent one; the top frame is frame 0.Run a shell builtin. This is useful when you wish to rename ashell builtin to be a function, but need the functionality of thebuiltin within the function itself.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop.If N is specified, resume at the N-th enclosing loop.Exit from within a FOR, WHILE or UNTIL loop. If N is specified,Bind a key sequence to a Readline function or a macro, or seta Readline variable. The non-option argument syntax is equivalentto that found in ~/.inputrc, but must be passed as a single argument:bind '"\C-x\C-r": re-read-init-file'.bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Remove NAMEs from the list of defined aliases. If the -a option is given,then remove all alias definitions.`alias' with no arguments or with the -p option prints the listof aliases in the form alias NAME=VALUE on standard output.Otherwise, an alias is defined for each NAME whose VALUE is given.A trailing space in VALUE causes the next word to be checked foralias substitution when the alias is expanded. Alias returnstrue unless a NAME is given for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-afFirtx] [-p] [name[=value] ...]typeset [-afFirtx] [-p] name[=value] ...enable [-pnds] [-a] [-f filename] [name ...]exec [-cl] [-a name] file [redirection ...]fc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] [pid | job]... or kill -l [sigspec]read [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]set [--abefhkmnptuvxBCHP] [-o option] [arg ...]export [-nf] [name[=value] ...] or export -preadonly [-af] [name[=value] ...] or readonly -ptrap [-lp] [arg signal_spec ...]ulimit [-SHacdflmnpstuv] [limit]for NAME [in WORDS ... ;] do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }variables - Some variable names and meaningsshopt [-pqsu] [-o long-option] optname [optname...]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]generated.not each is set.top directory. zero) is at the top. directory. shell can access. for new mail. looking for commands. primary prompt. `time' reserved word.entire set of commands.function as $0 .. $n.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) donethe COMMANDS are executed.pipeline are waited for. -p the pipe buffer size -s the maximum stack sizeprocesses.command name.or unfound, respectively.return `file'.be executed.the shell.File operators:String operators: -n STRING STRING1 = STRING2 STRING1 != STRING2 STRING1 < STRING2 STRING1 > STRING2Other operators:than ARG2.FILENAME is executed.processing. -o option-name by default.terminal to not be echoed.the argument to -u. -, + unary minus, plus ** exponentiation +, - addition, subtraction <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignmentrules above.otherwise.process group leader.anything in the history list.a short usage synopsis.job is used.string. then vi.the last command.Logout of a login shell.printed. \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslashwith the -E option.Obsolete. See `declare'.The flags are: -r to make NAMEs readonly -x to make NAMEs exportname only.Return a successful result.to be followed.break N levels. KEYSEQ is entered.unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [EXPR]cdcd [-L|-P] [dir]pwdpwd [-PL]truefalsedeclaretypesetlocallocal name[=value] ...echo [-neE] [arg ...]enableevaleval [arg ...]getoptsgetopts optstring name [arg]exit [n]fg [job_spec]bg [job_spec]help [-s] [pattern ...]jobsdisownletlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]shiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [n]time [-p] PIPELINE{ ... }{ COMMANDS ; }%%[DIGITS | WORD] [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirs [-clpv] [+N] [-N]shoptprintfprintf format [arguments]compgenZZ4[<x[[[D\\\]`]]]@^^^_X___`P``G`a\a=aa bdbbb4c=|cc=ccDddX=de@e=teee=0fxf=ff(ghg=ggg=$h`hg=hh=iTi=ftiii} jhjjjk`kkklXlllmDmmmnDnnno0odooopdpppqLqqqq8rlrrrs\sss$t=ptttu=`uuu8v\vvvw`www,xlxxxx$yTyyy8zzz{L{x{{|L||| }L}}} ~L~~~T,8NYfx4|lĀ T؁ h4|$=T|̄0hȅ0\=ĆT܇\=0=x =H=Ċ=<ȋ P܌$pL܎$\)؏Pؐ=4=@tܑDxP(\Д\===P=D==V=dzT==,X=И=<̙ LĚ Ě PLԜPȝ P؞ d,p\4l@dܣ Dؤ D|ĥ X<ԧ8\8hX̪0p=0p<p@خ$pL0|"=T=@ȳ T=ĴQj~L"6N^q=t@=h=,pHиdDغd4|ȼHн\ܾ=Xܿ d=<LX(pP`=4==\="$lP\=(l=(h=0t@ P;==PH LT(xDUc0=h0 t=%=0\4$P=T=j=T(pH|u(lX$h@=t= h8<` P,p<p0|(h,l./alias.def`%s': invalid alias namealias bind_builtinlvpVPsSf:q:u:m:r:x:%s: cannot read: %s`%s': cannot unbind%s can be invoked via , "%s"%s`%s': unknown function name%s is not bound to any keys. `%s': invalid keymap name-X DV DV %X DV DV X DV DV DV DV DV DV DV DV DV DV DV DV DV DV DV  X DV DV DV DV DV X W DV DV W W W W DV W W DV mV only meaningful in a `for', `while', or `until' looploop count%s %s %s NULL./cd.defOLDPWD=LPwrite error: %schdirCDPATHOLDPWD not setHOME not set./command.defpvVcommand_builtin/bin:/usr/bin:/sbin:/usr/sbin:/etc:/usr/etc%s: usage: %s: numeric argument required%s: not found%s: invalid option name%s: invalid number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtincommon.c`'%s: ambiguous job specSIGJUNK%2d) %sUnknown%s: invalid signal specification`%s': not a pid or valid job spec%s: error retrieving current directory: %s: %s +afiprtxF./declare.def%s %d %s %s: cannot destroy array variables in this waycannot use `-f' to make functionscan only be used in a function| } } } } } } } } } } } } } } } } } } } } } } } } } } 0} } } } } | } } } } } } } } } p} } a} } V} } } } @} neE./echo.defadnpsf:enable -n %s ./enable.def%s: not dynamically loadedenable %s %s: cannot delete: %scannot find %s in shared object %s: %scannot open shared object %s: %s             ؈  Ј    %s: file is too large%s: not a regular fileevalfile.c_evalfileparse_and_execute_topparse_and_executepe_disposeevalstring.ccla:./exec.def%s: cannot execute: %s~/.bash_logoutnot login shell: use `exit'There are stopped jobs. logout exit :e:lnrs./fc.def %c%s %sno command foundbash-fc%s: cannot open temp file: %shistory specificationfc builtin${FCEDIT:-${EDITOR:-vi}} 4 4 4 4 4 4 p 4 a 4 4 4 W F currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-t%s %s: hash table empty ./hash.defhits command                 %s: %s %s %s: cannot open: %sShell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.Shell commands matching keywords `These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. acd:npsrw./history.def%5d%c %s%s %s: history expansion failedhistory positioncannot use more than one of -anrw8  0                     lpnxrs./jobs.defjobs_builtinahrno other options allowed with `-x' Ծ p Ծ ` Ծ P @ Ծ Ծ Ծ Ծ  (%ld) - %sUnknown error%s: arguments must be process or job IDs./pushd.def %2d %sdirectory stack emptydirectory stack indexno other directorydirstackersa:d:n:p:t:u:./read.defread_builtinread error: %d: %s%d: invalid file descriptor: %s%s: invalid file descriptor specification%s: invalid timeout specificationN   < /               `  can only `return' from a function or sourced scriptallexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedvixtraceoff%-15s %s set %co %s ./set.defSHELLOPTSfv%s: cannot unset: readonly %s%s: cannot unset%s: not an array variablecannot simultaneously unset a function and a variabledeclare -%s ./setattr.def%s -%s afnp-ra%s: not a functionshift count./shift.def%s: file not found./source.deffilename argument requiredcannot suspend a login shellcannot suspend./test.deftrap -- %s %s ./trap.deftrap -- %s %d unknown               y     y y y ./type.def%s is hashed (%s) %s is %s alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is aliased to `%s' afptP-type-path-all`                 P     @                core file sizeblocksdata seg sizekbytesmax locked memorymax memory sizeopen filespipe size512 bytescpu timesecondsmax user processesvirtual memory(-%c) %-18s %16sunlimited(%s, -%c) ./ulimit.def`%c': bad command%s: cannot get limit: %s%s: cannot modify limit: %shardsoftagourwxSpu=%s,g=%s,o=%s -Sumask%s octal number%04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG./getopts.defcdable_varscdspellcheckhashcheckwinsizecmdhistdotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoregnu_errfmthistreedithistappendhistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echopsuoq%s: invalid shell option name-s-ushopt %s %s ./shopt.defcannot set and unset shell options simultaneously) ) ) ( ) ( ( #'-+ 0missing hex digit for \xwarning: %s: %shjlLtz./printf.deflld63 @3 @3 @3 @3 63 @3 @3 @3 @3 @3 @3 @3 @3 [3 [3 [3 [3 [3 [3 [3 [3 @3 @3 @3 @3 @3 @3 @3 63 @3 @3 @3 @3 @3 4 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 M3 @3 @3 @3 @3 4 4 4 @3 4 v4 @3 @3 @3 @3 @3 @3 @3 j4 @3 @3 @3 ^4 @3 R4 @3 F4 @3 3 t; .8 .8 .8 t; t; t; .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 .8 8 .8 .8 .8 .8 .8 .8 .8 .8 t; < < : t; t; t; .8 : .8 .8 .8 .8 : 8 .8 : .8 9 .8 8 .8 .8 8 `%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c arrayvarenabledhelptopicgrouprunningservicesetoptsignalstoppeduserbashdefaultdirnamesfilenamesnospaceplusdirs%s: invalid action name-rcomplete -o %s -a-b-d-f-g-j-k-v-A %s -G%s %s ./complete.def-W-P-X-F-Cabcdefgjko:prsuvA:G:W:P:S:X:F:C:%s: no completion specificationwarning: -C option may not work as you expectwarning: -F option may not work as you expect`M K OM K K @M /M K K K K K K K K M K K  M K K K L L K K K K K K K K L L L L L L L K K L L K K K 1L L K K K K K K getenv.csetlinebuf.citos.cBASH_REMATCHshmatch.cnetopen.csocketconnect%s: bad network path specification%ldm%d.%03dssh_makepathmakepath.cpathcanon.cpathphys.csh_realpathTMPDIR/var/tmp/usr/tmptmpfile.c%s/%s-%lushtmpw+stringlist.cstringvec.cshquote.c                                                                                                                                                          ؎                                                                                            strtrans.c              Ǐ Ǐ Ǐ Ǐ Ǐ Ǐ Ǐ Ǐ              ؐ                            H >   ؐ ΐ        Đ           j _  T I > 3              (                                                                  %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789abcdef0123456789ABCDEF5.0OAOBOCODOHOF hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~(arg: %d) l|h^0bB l|hwW^0bB l|h^0%bBabortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-completenext-historyoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertstart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-again "\'`@$><=;|&{(--More--Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete otherMetaControl-C-CTRL-blink-matching-parenbyte-orientedcompletion-ignore-caseconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprefer-visible-bellshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertbell-stylecompletion-query-itemsisearch-terminatorskeymapendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTabC-\M-term=mode=readline: %s readline: %s: line %d: %s $endif without matching $ifnoneaudiblevisible\C-%c"%s": %s %s can be found on ... %s is not bound to any keys # %s (not bound) "%s%s": "%s" %s%s outputs %s %s is set to `%s' set bell-style %s set comment-begin %s set editing-mode %s set %s %s bell-style is set to `%s' comment-begin is set to `%s' editing-mode is set to `%s' set keymap %s keymap is set to `%s' set isearch-terminators "%s" unknown parser directiveno closing `"' in key bindingprefix-meta~/.inputrcINPUTRCprint-completions-horizontally$else found without matching $ifset completion-query-items %d completion-query-items is set to `%d' isearch-terminators is set to "%s" * * * * * * * * W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* W* + W* W* W* W* + + W* + , &, W* W* W* W* W* W* W* 7, W* W* W* c, W* y, W* M, W* K+  a q` ` _ _ ^_ \%oreadline: debug: insert_some_chars: count (%d) != col (%d)   "                     /-_=~.#$@7DCclcrdceiimkHkIkdkhklkrkummmopcvbvscoli amkmMTxnX%lu ;&()|<> =() <>;&|$"'`\`"$:$*%^unrecognized history modifiersubstitution failedbad word specifierevent not foundno previous substitutionP6 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 w5 7 w5 w5 7 w5 w5 w5 w5 w5 w5 w5 7 p7 G7 P6 6 w5 w5 w5 5  ~ ~Out of memoryj i i i i i xi i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i ]i i i i i i i i i i i ]i ]i i i i i i i i i i i ]i i i i i i i i i ]i i i i i i j k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k j k k k k k k k k k k j j k k k k k k k k k k j k k k j k k k k j ^n @m @m @m n n 2o @m @m no o @m :p @m p @m @m @m @m @m @m @m @m @m @m @m @m -q q q @m @m fr @m @m @m @m @m @m @m @m @m @m @m @m @m r !s @m @m @m @m @m @m @m x @m @m @m @m @m s @m @m @m @m +t x ft @m t @m t @m @m 'u u @m x xv @m @m v w @m @m @m x @m @m x "y @m y bwxbxseohchsdadbmihzulxonx5iHCNRNPcchlYAYBYCYDYEYFYGncNLxrlmsgpbvtwsNllhlwMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpdCdNdBdTknbtblCCcmCMdltidmmhmkmrsoaefsi1i3ipkbkakCktkDkLkMkEkSk0k1k;k2k3k4k5k6k7k8k9kAkNkPkFkRkTl0l1lal2l3l4l5l6l7l8l9nwDLDOSFALRISRpkplpxpfporpr1r2r3rfcvscsfsrsawiuchuiPK1K3K2K4K5pOrPpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFEFFFGFHFIFJFKFLFMFNFPFQFRFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfDKCWWGHUDIQDTOfhPAWAu0u1u2u3u4u5u6u7u8u9ocIcIpspSfSbZAZBZCZDZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmAFABxldvcis0s1s2s3XyZzYvYwYxYyYzYZS5S6S7S8XhXlXoXrXtXvsAsLi2nlbckoG3G1G4GRGLGUGDGHmlmubxC=CC=DcD=D4 D DD)8V03TSDDDDD"D%D(D+D8.D1D4D7D:D=D@DCDZUFD=IDRLD==ODRDUDXD[D^DaDdDIcgDjDmDpDsDvDyD|DDDDDDDDDDDDDD@DDDDDDD^= +1[=4(4DDKP 9Dc#=a=D& DDDg=D DDdMD`$4d=:=DDcD8#DDDDDDDp=DDEEE E EEEEEEE!Es=m=$Ev=j='E*Ey=-E0E3E|=v436E9EFAFDFGFJFMFPFSFVFYF\F_FY9bFeFhFkFnFqFtFwFzF}FFFFFFFFFFFFFe8FFFFFFFFFF14FFF3FFFFFFFFFFFFFFFFFFGGG G GGGGGGG"GZ8%G:(G+G.G1G4G7GG:G=G@GCGFGIGLGOGRGUGXG[G^GaGdGgGjGmGpGsGvGyG|G3GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGHHH H HHHHHHH!H$H'H*H-HG=0H3H6H9Hminfo.mi_magic2 == 0x5555nunits < 30 malloc: %s:%d: assertion botched malloc: block on free list clobberedfree: called with unallocated block argumentfree: underflow detected; mh_nbytes out of rangefree: start and end chunk sizes differfree: called with already freed block argumentrealloc: called with unallocated block argumentrealloc: underflow detected; mh_nbytes out of rangerealloc: start and end chunk sizes differ#                ;8aTaܝtaaa0= H ! . 1`q 3 D= G L @R 8\ `q \7 t(0 <c    "#$! %=&'3( > <--5{D};>(-)P<|<&y 8!M3$)- 4 : K g 45{D}d@k b  {();&| #  x+d =h3}s33~33~3 3}3 _33333333p}4p} 4p}44P `}R yG}#4}+4}44?4M4P4Z4889$929+abefh$vihkmlnpTr\tuxvtxpBvC|ELH vI`PdTP)G GGG!G(G0G8G?GFGNGVG^GfGnGvG~GGGGGGGGGGGGGGGGH HH$H-H8HCHNHYHdHoHzHHHHHHHHHHHHIII)I4I?IJIUI`IkItI4zIh3   Q&R.RR,3 0S8SFS=WJWP0 / 0 P1 1 p/ / `/ . @- ,  + + * 0* p) ( B H ## H~R  Q  ` U ` [  @ Z  4 @\ $ d\  (d  +<`  @DSh  DSJh  JOh  O`h d U  ] e kN Є  `  <" @  4  tP lx  `0 0  .  nU` @ $ \/ |!P  %7 @  < `  (:  Gc@ `XG @b`  hr@  y@  H  >  %=  9    p X")D+. 0-`+M384$:tHdl>XFUDWl8v^0 0  `F$ ( 5 3@U TY @a&B @  2e:ECTMhUHnUHx0 Z4p `vuk}mCnfDbutPHL @ p7 v@  xt1c /d6Df%/lKDm]DnmpxsDtuv D\PHDx"`+:HCKPsT]`xkLv(4<dx `v- 8 . H ` pz Ts X- 1 d? ܇J  t1?-a#:bc db@#cetf#T #g @juk##s$$$ $@u9v$ $'$0$:$B$@6.ij... .P . . . 0 . / /` $/` 9/ K/ _/  o/ / /P 30 / / /@ 0 / /  0 0 000 >0 G M0`I Y0L h0 {0 0 0 0p 0 0 0 00c /  1@ "1@ 91P H1 [1` / k1 / w1P 1p  5 45 \5 50 1 1  1 1 1W 1 1@c 2 2 4@ *2 :20 4 E2P U2P e2p p2p u2 20 2 2г 2@ 2 2 2 20 2 3p 3p 3 13 :3p C3 R3 a3 n3 }3 3 3 3 3 3 3@ 3 3 3P 30 3 4 4 $4@ 24 D4p M40 ^4` k4 y4` 4 4 4 4 4 4 4 4 40 4 5`         0 P   P     @c 0c P   г    0    в                                                                                                                                                                                                                                     P  P P p   @c 0c P   г  в  P  p 0  p      p p p p p p p p p        @  0 @       `  `     p    @    p         в `  `    W p p                                 0     0  @ P               `                                  `     0    P @ 0   @        0 P  P P p   @c 0c P   г   p                                                                                                                                                                                                                                  P  U5d46:68?6H6K6Q6,f6, t66(6,666 6\6@67X$7(?7R7@\7Dh7y7T: 707,7$ 777778` 8p= WS< 8`< 3; ,8 > @8= 86 G89 8 M80W U8Y8]8d8 h8 p8 t8 {88 8 8 < L=  U= X=|3t4D[=d^=Xa=Ld=\#<g=pj= m= p= v4 s= v= y= 3 |= 9x= = =`#T= = c ==^!M<U ?? =} S\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWDVTVdVtVVVVVVVW hW W W 8W DW xW W W W WXX X0X@XPX`XpXXXXXXXXXXYY Y0YV ]?^@P^[^\^\_]\_^_^___`0`{\`{`|`}a}`a~xa!b%b)b-b1b5b49b?bYBb  E y Eb Hb F Ub _b bb rbubxb|bbbbbbbbbbY8b3bbb=Sbc?c@c[\d\d],d^7d^Id_Td`ad{ld{d|d}d}6~U8  @ @ @ @zR| 0;PAB E<`<AB E\D> AB E|0?AB EL  h+` Eu 8x(o`ooTζ޶.>N^n~η޷.>N^n~θ޸.>N^n~ι޹.>N^n~κ޺.>N^n~λ޻.>N^n~μ޼.>N^n~ν޽.>N^n~ξ޾.>N^n~ο޿.>N^n~.>N^n~GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.3.2GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.data.eh_frame.dynamic.ctors.dtors.jcr.got.bss.comment 44HH !hh.' ``0P{/+Eu7o jDo``0S 0(\ 1x e6`6 kA4Jq ԋ w  |\ |h| ,p Y I TTJ $$K ,,K 44K 88K   N |L  N Z